Search Site
  • 0
    My Cart

    Click Here to Find How Many Items You Have Added:)

    image loader

    Adding item(s) to cart......

Home >> Signaling Pathways >> Proteases >> ACE

ACE

ACE, also known as angiotensin-converting enzyme, indirectly increases blood pressure by converting angiotensin I to angiotensin II and subsequently constricting the vessels.

Products for  ACE

  1. Cat.No. Product Name Information
  2. GC61858 (R)-MLN-4760 (R)-MLN-4760, the R-enantiomer of MLN-4760, is an ACE2 inhibitor, with an IC50 of 8.4 μM. (R)-MLN-4760 Chemical Structure
  3. GP10077 Angiotensin (1-7)

    Ang-(1-7) (H - Asp - Arg - Val - Tyr - Ile - His - Pro - OH) is an endogenous peptide fragment that can be produced from Ang I or Ang II via endo- or carboxy-peptidases respectively[1].

     Angiotensin (1-7) Chemical Structure
  4. GC61496 Angiotensin (1-7) (acetate) Angiotensin 1-7 (Ang-(1-7)) acetate is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin (1-7) (acetate) Chemical Structure
  5. GA20760 Angiotensin A (1-7) Angiotensin A (1-7), a member of the renin-angiotensin system (RAS), a vasoactive peptide, is an endogenous ligand of the G protein-coupled receptor MrgD. Angiotensin A (1-7) Chemical Structure
  6. GC11228 Benazepril ACE inhibitor Benazepril Chemical Structure
  7. GC17941 Benazepril HCl Benazepril HCl, an angiotensin converting enzyme inhibitor, which is a medication used to treat high blood pressure. Benazepril HCl Chemical Structure
  8. GC16223 Captopril An ACE inhibitor Captopril Chemical Structure
  9. GC12859 Cilazapril ACE inhibitor Cilazapril Chemical Structure
  10. GC17667 Cilazapril Monohydrate angiotensin-converting enzyme (ACE) inhibitor Cilazapril Monohydrate Chemical Structure
  11. GC64348 Cyanidin 3-sambubioside chloride Cyanidin 3-sambubioside chloride (Cyanidin-3-O-sambubioside chloride), a major anthocyanin, a natural colorant, and is a potent NO inhibitor. Cyanidin 3-sambubioside chloride Chemical Structure
  12. GC38766 Delapril hydrochloride Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases. Delapril hydrochloride Chemical Structure
  13. GC38768 Deserpidine Deserpidine (Harmonyl) is an alkaloid isolated from the root of Rauwolfia canescens related to Reserpine. Deserpidine Chemical Structure
  14. GC38197 Diminazene aceturate An anti-protozoal diamidine Diminazene aceturate Chemical Structure
  15. GC16192 Diminazene Aceturate Effective trypanocidal agent Diminazene Aceturate Chemical Structure
  16. GC32499 Enalapril (MK-421) Enalapril (MK-421) (MK-421) is an angiotensin-converting enzyme (ACE) inhibitor, can be used for hypertensive diseases research. Enalapril (MK-421) Chemical Structure
  17. GC30421 Enalapril D5 maleate (MK-421 (D5 maleate)) Enalapril (MK-421) D5 maleate is deuterium labeled Enalapril, which is an angiotensin converting enzyme (ACE) inhibitor. Enalapril D5 maleate (MK-421 (D5 maleate)) Chemical Structure
  18. GC10142 Enalapril Maleate angiotensin-converting enzyme (ACE) inhibitor Enalapril Maleate Chemical Structure
  19. GC35983 Enalaprilat D5 Enalaprilat D5 (MK-422 D5) is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor. Enalaprilat D5 Chemical Structure
  20. GC35984 Enalaprilat D5 Sodium Salt Enalaprilat (MK-422) D5 Sodium Salt is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor. Enalaprilat D5 Sodium Salt Chemical Structure
  21. GC15493 Enalaprilat Dihydrate angiotensin-converting enzyme (ACE) inhibitor Enalaprilat Dihydrate Chemical Structure
  22. GC47370 Fosinopril (sodium salt) A prodrug form of fosinoprilat Fosinopril (sodium salt) Chemical Structure
  23. GC16109 Fosinopril sodium A prodrug form of fosinoprilat Fosinopril sodium Chemical Structure
  24. GC32611 H-Ile-Pro-Pro-OH H-Ile-Pro-Pro-OH, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC50 of 5 μM. H-Ile-Pro-Pro-OH Chemical Structure
  25. GC60190 H-Ile-Pro-Pro-OH hydrochloride H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC50 of 5 μM. H-Ile-Pro-Pro-OH hydrochloride Chemical Structure
  26. GC32489 Hemorphin-7 Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin-7 Chemical Structure
  27. GC13078 Imidapril HCl Imidapril HCl (TA-6366) is an orally active angiotensin-converting enzyme (ACE) and MMP-9 inhibitor. Imidapril HCl Chemical Structure
  28. GC32600 Imidaprilate (6366A) Imidaprilate (6366A) is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC50 of 2.6 nM, and is used in the research of hypertensive disease. Imidaprilate (6366A) Chemical Structure
  29. GC32520 Leucylarginylproline Leucylarginylproline is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 0.27μM. Leucylarginylproline Chemical Structure
  30. GC16307 Lisinopril angiotensin-converting enzyme (ACE) inhibitor Lisinopril Chemical Structure
  31. GC11266 Lisinopril dihydrate ACE inhibitor Lisinopril dihydrate Chemical Structure
  32. GC31354 MLN-4760 An ACE2 inhibitor MLN-4760 Chemical Structure
  33. GC11655 Moexipril HCl Moexipril HCl (RS-10085) is an orally active inhibitor of angiotensin-converting enzyme (ACE), and becomes effective by being hydrolyzed to moexiprila (hydrochloride). Moexipril HCl Chemical Structure
  34. GC64534 Moveltipril Moveltipril (Moveltipril calcium; MC-838) is a potent angiotensin converting enzyme (ACE) inhibitor. Moveltipril Chemical Structure
  35. GC33889 N-Acetyl-Ser-Asp-Lys-Pro

    N-Acetyl-Ser-Asp-Lys-Pro, an endogenous tetrapeptide secreted by bone marrow, is a specific substrate for the N-terminal site of ACE.

     N-Acetyl-Ser-Asp-Lys-Pro Chemical Structure
  36. GC36684 N-Acetyl-Ser-Asp-Lys-Pro TFA N-Acetyl-Ser-Asp-Lys-Pro (TFA), an endogenous tetrapeptide secreted by bone marrow, is a specific substrate for the N-terminal site of ACE. N-Acetyl-Ser-Asp-Lys-Pro TFA Chemical Structure
  37. GC32560 NCX899 NCX899 is a NO-releasing derivative of enalapril, and shows inhibitory activity against angiotensin-converting enzyme (ACE) activity. NCX899 Chemical Structure
  38. GC61962 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions. NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ Chemical Structure
  39. GC16752 Olmesartan medoxomil A prodrug form of olmesartan Olmesartan medoxomil Chemical Structure
  40. GC34019 Omapatrilat (BMS-186716) Omapatrilat (BMS-186716) is a dual inhibitor of the metalloproteases ACE and NEP with Ki values of 0.64 and 0.45 nM, respectively. Omapatrilat (BMS-186716) Chemical Structure
  41. GC16871 Perindopril ACE inhibitor Perindopril Chemical Structure
  42. GC15166 Perindopril Erbumine ACE inhibitor Perindopril Erbumine Chemical Structure
  43. GC25723 Perindopril L-Arginine Perindopril L-Argininel is a prodrug that is metabolized in the liver to its active diacid metabolite perindoprilat, which is rapidly and extensively absorbed, and become one of the highest tissue angiotensin-converting enzyme (ACE) affinities among the ACE inhibitors. Perindopril L-Arginine Chemical Structure
  44. GC16768 Phosphoramidon Disodium Salt Phosphoramidon Disodium Salt is a metalloprotease inhibitor. Phosphoramidon Disodium Salt Chemical Structure
  45. GC32544 Pivalopril (Pivopril) Pivalopril (Pivopril) is a new orally active angiotensin converting enzyme (ACE) inhibitor. Pivalopril (Pivopril) Chemical Structure
  46. GC12368 Quinapril HCl Quinapril (hydrochloride) (CI-906) is a prodrug that belongs to the angiotensin-converting enzyme (ACE) inhibitor class of medications. Quinapril HCl Chemical Structure
  47. GC63342 Quinaprilat-d5 Quinaprilat-d5 is a deuterium-labeled Quinaprilat. Quinaprilat-d5 Chemical Structure
  48. GC15760 Ramipril angiotensin-converting enzyme (ACE) inhibitor Ramipril Chemical Structure
  49. GC10694 Ramiprilat angiotensin-converting enzyme inhibitor Ramiprilat Chemical Structure
  50. GC65304 Rentiapril Rentiapril is an orally active angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Rentiapril Chemical Structure
  51. GC32557 Rentiapril racemate (SA-446 racemate) Rentiapril racemate (SA-446 racemate) (SA-446 racemate) is the racemate of Rentiapril. Rentiapril racemate (SA-446 racemate) Chemical Structure
  52. GC11560 Resorcinolnaphthalein ACE2 activator Resorcinolnaphthalein Chemical Structure
  53. GC69856 Sampatrilat

    Sampatrilat (UK-81252) is a potent orally active vasopeptidase inhibitor that inhibits both angiotensin-converting enzyme (ACE) and neutral endopeptidase (NEP). Sampatrilat has 12.4 times greater inhibition of C-domain ACE (Ki=13.8 nM) compared to N-domain ACE (Ki=171.9 nM). Sampatrilat (UK-81252) can be used for research related to chronic heart failure and blood pressure regulation.

     Sampatrilat Chemical Structure
  54. GC50650 SBP1 SBP1 Chemical Structure
  55. GC50653 SBP1-FITC SBP1-FITC Chemical Structure
  56. GC31511 Sinapinic acid (Sinapic acid) Sinapinic acid (Sinapic acid) (Sinapic acid) is a phenolic compound isolated from Hydnophytum formicarum Jack. Sinapinic acid (Sinapic acid) Chemical Structure
  57. GC16894 Spinorphin A peptide inhibitor of enkephalin-degrading enzymes Spinorphin Chemical Structure
  58. GC64597 Spirapril hydrochloride Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril hydrochloride Chemical Structure
  59. GC17034 Temocapril HCl Temocapril HCl is an orally active angiotensin-converting enzyme (ACE) inhibitor. Temocapril HCl Chemical Structure
  60. GC13952 Trandolapril angiotensin-converting enzyme (ACE) inhibitor Trandolapril Chemical Structure
  61. GC64874 Trandolapril D5 Trandolapril D5 (RU44570 D5) is a deuterium labeled Trandolapril (RU44570). Trandolapril D5 Chemical Structure
  62. GC64872 Trandolaprilate D5 Trandolaprilate D5 is a deuterium labeled Trandolaprilate (Trandolaprilat). Trandolaprilate D5 Chemical Structure
  63. GC32534 Utibapril (FPL 63547) Utibapril (FPL 63547) is an angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activities. Utibapril (FPL 63547) Chemical Structure
  64. GC37902 Vicenin 2 Vicenin 2 is an angiotensin-converting enzyme (ACE) inhibitor (IC50=43.83 μM) from the aerial parts of Desmodium styracifolium. Vicenin 2 Chemical Structure
  65. GC37903 Vicenin 3 Vicenin 3 is an angiotensin-converting enzyme (ACE) inhibitor (IC50=46.91 μM) from the aerial parts of Desmodium styracifolium. Vicenin 3 Chemical Structure
  66. GC61786 Vicenin-1 Vicenin 1 is a C-glycosylflavone that has an inhibitory effect on angiotensin-converting enzyme (ACE)(IC50=52.50 μM). Vicenin-1 Chemical Structure
  67. GC37972 Zofenopril Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM. Zofenopril Chemical Structure
  68. GC11513 Zofenopril calcium angiotensin converting enzyme (ACE) inhibitor Zofenopril calcium Chemical Structure

67 Item(s)

per page

Set Descending Direction