Home>>Peptides>> Amyloid β protein>>Amyloid Beta-Peptide (1-40) (human)

Amyloid Beta-Peptide (1-40) (human)

Catalog No.GP10118

Amyloid Beta-Peptide (1-40) (human) Chemical Structure

Amyloid precursor protein

Size Price Stock Qty
Endostatin (84-114)-NH2 (JKC367) 1mg
$80.00
In stock
1mg
$87.00
In stock
Endostatin (84-114)-NH2 (JKC367) 5mg
$240.00
In stock
5mg
$250.00
In stock
Endostatin (84-114)-NH2 (JKC367) 10mg
$400.00
In stock
10mg
$432.00
In stock
Endostatin (84-114)-NH2 (JKC367) 25mg
$560.00
In stock
25mg
$595.00
In stock

Customer Reviews

Based on customer reviews.

Tel: (626) 353-8530 Email: sales@glpbio.com

Sample solution is provided at 25 µL, 10mM.

Quality Control

Quality Control & SDS

View current batch:

Protocol

Cell experiment: [1]

Cell lines

CA1 pyramidal cells

Preparation method

The solubility of this peptide in sterile water is >10 mM. Stock solution should be splited and stored at -80°C for several months.

Reaction Conditions

200 nM, 20 min

Applications

Aβ (1–40) reversibly increased IBa evoked at +20 mV. This increase was observed for 6 of 11 cells and reached 1.74±0.06. The activation curve showed that Aβ (1–40) caused an apparent voltage-dependent increase in IBa, with an enhancement of IBa at the test potentials between 0 and +30 mV.

Animal experiment: [2]

Animal models

Male Charles River Wistar rats

Dosage form

Intraperitoneal injection, 400 mg/kg

Applications

A statistically significant decrease in basal ACh release (-30%) was detected one week after the injection of Aβ (1-40). 30 days after the Aβ (1-40) peptide injection, the decrease in Ach release was still statistically significant (-38%). K+-stimulated ACh release was similarly affected by the treatment. Aβ (1–40) treatment induced a significant decrease in the stimulated release on day 14 after lesioning (-43%).

Other notes

Please test the solubility of all compounds indoor, and the actual solubility may slightly differ with the theoretical value. This is caused by an experimental system error and it is normal.

References:

[1] Rovira C, Arbez N, Mariani J. Aβ (25–35) and Aβ (1–40) act on different calcium channels in CA1 hippocampal neurons. Biochemical and biophysical research communications, 2002, 296(5): 1317-1321.

[2] Giovannelli L, Casamenti F, Scali C, et al. Differential effects of amyloid peptides β-(1–40) and β-(25–35) injections into the rat nucleus basalis. Neuroscience, 1995, 66(4): 781-792.

Background

Amyloid β-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (Aβ or Abeta) is a peptide of 36–43 amino acids that is processed from the Amyloid precursor protein. While best known as a component of amyloid plaques in association with Alzheimer's disease, evidence has been found that Aβ is a highly multifunctional peptide with significant non-pathological activity[1]. Aβ is the main component of deposits found in the brains of patients with Alzheimer's disease. Brain Aβ is elevated in patients with sporadic Alzheimer’s disease. Aβ is the main constituent of brain parenchymal and vascular amyloid, it contributes to cerebrovascular lesions and is neurotoxic[2]. Aβ protein is generated by successive action of the β and γ secretases. The γ secretase, which produces the C-terminal end of the Aβ peptide, cleaves within the transmembrane region of APP and can generate a number of isoforms of 36-43 amino acid residues in length. The most common isoforms are Aβ40 and Aβ42; the longer form is typically produced by cleavage that occurs in the endoplasmic reticulum, while the shorter form is produced by cleavage in the trans-Golgi network[3].

Reference:
1. Lahiri DK, Maloney B (September 2010). "Beyond the signaling effect role of amyloid–β42 on the processing of AβPP, and its clinical implications". Exp. Neurol. 225 (1): 51–4.
2. Hardy J, Duff K, Hardy KG, Perez-Tur J, Hutton M (September 1998). "Genetic dissection of Alzheimer's disease and related dementias: amyloid and its relationship to tau". Nat. Neurosci. 1 (5): 355–8.
3. Hartmann T, Bieger SC, Brühl B, Tienari PJ, Ida N, Allsop D, Roberts GW, Masters CL, Dotti CG, Unsicker K, Beyreuther K (September 1997). "Distinct sites of intracellular production for Alzheimer's disease A beta40/42 amyloid peptides". Nat. Med. 3 (9): 1016–20.

Chemical Properties

Cas No. 131438-79-4 SDF
Synonyms Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Chemical Name N/A
Canonical SMILES N/A
Formula C194H295N53O58S M.Wt 4329.86
Solubility ≥ 43.28mg/mL in DMSO Storage Desiccate at -20°C
General tips For obtaining a higher solubility , please warm the tube at 37 ℃ and shake it in the ultrasonic bath for a while.Stock solution can be stored below -20℃ for several months.
Shipping Condition Evaluation sample solution : ship with blue ice
All other available size: ship with RT , or blue ice upon request

In vivo Formulation Calculator (Clear solution)

Step 1: Enter information below (Recommended: An additional animal making an allowance for loss during the experiment)

mg/kg g μL

Step 2: Enter the in vivo formulation (This is only the calculator, not formulation. Please contact us first if there is no in vivo formulation at the solubility Section.)

% DMSO % % Tween 80 % ddH2O
%DMSO %

Calculation results:

Working concentration: mg/ml;

Method for preparing DMSO master liquid: mg drug pre-dissolved in μL DMSO ( Master liquid concentration mg/mL, Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug. )

Method for preparing in vivo formulation: Take μL DMSO master liquid, next addμL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O, mix and clarify.

Method for preparing in vivo formulation: Take μL DMSO master liquid, next add μL Corn oil, mix and clarify.

Note: 1. Please make sure the liquid is clear before adding the next solvent.
2. Be sure to add the solvent(s) in order. You must ensure that the solution obtained, in the previous addition, is a clear solution before proceeding to add the next solvent. Physical methods such as vortex, ultrasound or hot water bath can be used to aid dissolving.
3. All of the above co-solvents are available for purchase on the GlpBio website.

  • Molarity Calculator

  • Dilution Calculator

Mass
=
Concentration
x
Volume
x
MW*
 
 
 
**When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and MSDS / CoA (available online).

Calculate

Reviews

Review for Amyloid Beta-Peptide (1-40) (human)

Average Rating: 5 ★★★★★ (Based on Reviews and 25 reference(s) in Google Scholar.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%
Review for Amyloid Beta-Peptide (1-40) (human)

GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.

Required fields are marked with *

You may receive emails regarding this submission. Any emails will include the ability to opt-out of future communications.