نتائج البحث عن: 'Peptide'

استهداف: Histones/Histone Peptides Neuropeptide FF/AF Receptors Neuropeptide S Receptor Formyl Peptide Receptors Peptide Receptors Cancer Biology Peptides Neuroscience Peptides Peptide Inhibitors and Substrate Cell Penetrating Peptide Natriuretic Peptide Receptors Peptide Coupling Reagents Isotope-Labeled Amino Acids & Peptides Tag Peptides Neuropeptides Peptide Hormones Peptides B type Natriuretic Peptide Polymerase (RNA) (DNA directed) Polypeptide

القسم: Caspase Aminopeptidase ACE Cathepsin HCV Protease MMP Thrombin Other Proteases Endogenous Metabolite Mitochondrial Metabolism PAI-1 PCSK9 Pyroptosis Bax Bcl-2 Family TNF-α Other Apoptosis PD-1/PD-L1 interaction Histone Demethylases Histone Methyltransferase Citrullination Histones/Histone Peptides Neuronal Metabolism Bone Growth & Remodeling Carbohydrate Metabolism Cofactors & Vitamins Dyslipidemias Necrosis Nutrient Sensing Reproductive Biology PKA p38 JNK cAMP Broad Spectrum Protein Kinase Inhibitor c-MET Insulin Receptor Src Trk VEGFR DNA/RNA Synthesis Casein Kinase AMPK GSK-3 S6 Kinase Antibiotic HCV HIV Influenza virus SARS-CoV Antifungal Bacterial Fungal Parasite Entry/Fusion Inhibitors Antiviral Microtubule/Tubulin PAK Dynamin ECM & Adhesion Molecules Endomembrane System & Vesicular Trafficking Proteolysis Cytoskeleton & Motor Proteins Autophagy STAT PKC TGF-β Receptor Integrin PAR1 Neuropeptide FF/AF Receptors Formyl Peptide Receptors 5-HT Receptor Adrenergic Receptor Apelin Receptor Angiotensin Receptor Bombesin Receptors Bradykinin Receptors Calcitonin and Related Receptors Cannabinoid Receptor CaSR CCR Chemokine Receptors CXCR Endothelin Receptor Galanin Receptors Ghrelin Receptors GIP Receptor Glucagon Receptor Melanocortin (MC) Receptors Motilin Receptor Non-selective CRF Neurotensin Receptors NOP Receptor NPY Receptors Oxytocin Receptors Peptide Receptors Protease-Activated Receptors Secretin Receptors Vasopressin Receptor Urotensin-II Receptor VIP Receptors Neuromedin U Receptors mAChR Neurokinin Receptor YAP AMPAR Calcium Channel Pannexin-1 Potassium Channel Sodium Channel TRP Channel Kainate Receptors Na+/K+ ATPase nAChR Cancer Biology Peptides Tumor Microenvironment Cell Migration & Metastasis GnRH Opioid Receptor Thyroid hormone Receptor TRH Glucocorticoids & Mineralocorticoids AChR Alzheimer Amyloid β CGRP DAPK Gap Junction GluR Histamine Receptor Neuroscience Peptides CaMK Behavioral Neuroscience Neuroendocrinology Neuroprotection Ophthalmology Pain Research Diabetes NAFLD & NASH Obesity Other Signal Transduction Apoptosis NF-κB Interleukin Related Complement System IFNAR NOD-like Receptor (NLR) STING Reactive Oxygen Species Glutathione Adaptive Immunity Allergy Arthritis Autoimmunity Gastric Disease Innate Immunity Pulmonary Diseases Acute Phase Reactants Arrhythmia Atherosclerosis Chronic Kidney Disease Coagulation & Hemostasis Diabetic Nephropathy Endothelium Heart Failure Hypertension Myocardial Contractility Myocardial Hypertrophy Myocardial Infarction Serum Proteins Smooth Muscle Cells Stroke Thrombosis Vasoconstriction Vasodilation Antioxidants Carbohydrate Oxidation Lipid Peroxidation Pro-Oxidant Activity Adenylate cyclase Cell Penetrating Peptide Cytokine Enzyme Substrates / Activators Fluorescent Probes Glycoprotein Guanylate Cyclase MDR multidrug resistance Myosin Natriuretic Peptide Receptors Nitric Oxide Renin Tachykinin Transcription Factors Others Cyclase Negative Controls Toxicology Antiparasitics Peptide Coupling Reagents Amino Acids and Derivatives Natural Products Cyanine Dyes Dyes, Stains & Indicators Enzyme Substrates Fluorescence Biochemical Assay Reagents Tag Peptides Amyloid β protein Neuropeptides Peptide Hormones Dengue Yellow Fever Food-Borne Illnesses MRSA Pneumonia Tuberculosis Candidiasis Parasitic Diseases Quorum Sensing Macrophage Migration Inhibitory Factor Superoxide Dismutase

القط. رقم اسم المنتج بيانات
GC31523 Peptide YY (PYY) (3-36), human (Peptide YY (3-36)) الببتيد YY (PYY) (3-36) ، الإنسان (الببتيد YY (3-36)) هو هرمون الأمعاء الذي يعمل كمحفز لمستقبل Y2 لتقليل الشهية.
GC44598 Peptide YY (human) (trifluoroacetate salt)

Peptide Tyrosine Tyrosine

Peptide YY (PYY) is a 36-amino acid peptide and anorectic gut hormone agonist for the neuropeptide Y receptors Y1, Y2, Y5, and Y6 with EC50 values of 0.7, 0.58, 1, and 0.8 nM, respectively, for supression of forskolin-induced cAMP accumulation.
GC72259 Peptide A5K Peptide A5K (INF7-A5K-TAT) is an RNP delivery peptide that delivers CRISPR RNPs to T cells.
GC63855 Peptide YY (PYY) (3-36), porcine TFA الببتيد YY (PYY) (3-36) ، TFA هو هرمون الأمعاء الذي يعمل كمحفز لمستقبل Y2 لتقليل الشهية
GC36874 Peptide YY (PYY) (3-36), human TFA
GC72139 Peptide5 TFA Peptide5 TFA, a connexin 43 mimetic peptide, reduces animals swelling, astrogliosis, and neuronal cell death after spinal cord injury.
GC63141 Peptide 74 الببتيد 74 عبارة عن ببتيد اصطناعي يحتوي على تسلسل أولي لمصفوفة البروتين المعدني (MMP). يثبط الببتيد 74 الشكل المنشط لكولاجيناز من النوع الرابع 72 كيلو دالتون في المختبر.
GC32335 Peptide T TFA الببتيد T (TFA) هو octapeptide من منطقة V2 من HIV-1 gp120
GC32309 Peptide T الببتيد T هو ثماني ببتيد من منطقة V2 من HIV-1 gp120
GC31767 Peptide 401 الببتيد 401 ، عامل تحبيب قوي للخلايا البدينة من سم النحل ، يمنع زيادة نفاذية الأوعية الدموية بسبب الحقن داخل الأدمة للعديد من مسببات التشنج العضلي الملساء (الهيستامين ، و 5-HT)
GP10131 Peptide YY(3-36), PYY, human
GC36873 Peptide C105Y الببتيد C105Y ، ببتيد صناعي مخترق للخلايا يعتمد على تسلسل الأحماض الأمينية المطابقة للمخلفات 359-374 من α1-antitrypsin ، يعزز التعبير الجيني من جزيئات الحمض النووي النانوية
GC52502 Peptide YY (3-36) (trifluoroacetate salt)

Pancreatic Peptide YY, Peptide Tyrosine Tyrosine
A satiety hormone
GA23355 Peptide Lv (rat) Peptide Lv has been discovered via a computational bioinformatics-based screening process. The neuropeptide is expressed in retinal photoreceptor layer, hippocampus, olfactory bulb, cerebellum, cerebral cortex, lung, spleen, liver and intestine. Peptide Lv enhances L-type voltage-gated calcium channel (L-VGCC) currents in retinal photoreceptors.
GC63347 Peptide 78 الببتيد 78 ، وهو سيتوكين كيميائي ، وهو عبارة عن 78 بروتين من الأحماض الأمينية من عائلة الجينات الكيميائية العملاقة IL-8 أو CX-C
GC30452 Peptide YY (PYY), human

Peptide Tyrosine Tyrosine
الببتيد YY (PYY) هو هرمون الأمعاء الذي ينظم الشهية ويمنع إفراز البنكرياس
GC50439 Peptide5 Peptide5 ، كونيكسين 43 ببتيد مقلد ، يقلل من تورم الحيوانات ، وداء نجمي ، وموت الخلايا العصبية بعد إصابة الحبل الشوكي في المختبر: الببتيد 5 ، يقلل بشكل كبير من درجة إصابة الحبل الشوكي (SCI) في نموذج القوارض خارج الجسم الحي
GC30233 Peptide M الببتيد M هو حمض أميني صناعي (18 حمضًا أمينيًا في الطول يتوافق مع مواضع الأحماض الأمينية 303-322 من مستضد الأبقار: DTNLASSTIIKEGIDKTV) ، قادر على إحداث التهاب القزحية المناعي الذاتي التجريبي في القرود وخنازير هارتلي غينيا وكذلك فئران لويس
GA23356 Peptide WE-14 WE-14, a chromogranin A-derived peptide, was isolated from a human ileal carcinoid tumor. Its sequence WSKMDQLAKELTAE is highly conserved in many mammalian species and flanked by typical processing sites. Such factors would indicate a potential physiological role for peptide WE-14.
GA23357 Peptide YY (13-36) (canine, mouse, porcine, rat) This C-terminal fragment was shown to suppress the noradrenaline release from sympathetic nerve endings. It thereby mimics the effects of PYY and NPY at presynaptic (Y?) receptors. The peptide was also able to compete with NPY for essentially all binding sites in rat brain.
GA23358 Peptide YY (canine, mouse, porcine, rat)
GC30535 Transdermal Peptide (TD 1 (peptide))
Transdermal Peptide (TD 1 (peptide)), consisting of 11 amino acids, is the first transdermal enhancing peptide discovered by phage display.
GC31527 C-Peptide, dog (C-Peptide (dog))

C-Peptide (dog)
C-Peptide ، كلب (C-Peptide (كلب)) هو أحد مكونات proinsulin ، يتم إطلاقه من خلايا بيتا البنكرياس في الدم مع الأنسولين.
GC31172 δ-Sleep Inducing Peptide (Delta-Sleep Inducing Peptide) &delta ؛ - الببتيد المحفز للنوم (الببتيد الذي يحفز النوم) عبارة عن ببتيد عصبي ، مع خصائص مضادة للأكسدة ومزيل للقلق.
GC35123 3X FLAG peptide TFA
GC34397 Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) الببتيد الصناعي Sphistin (12-38 ، Fitc في N-Terminal-Fluorescently Labeled Peptide) عبارة عن شظايا مقطوعة من الببتيد الاصطناعي Sphistin الذي يُظهر نشاطًا قويًا مضادًا للميكروبات
GP10149 3X FLAG Peptide

H-Met-Asp-Tyr-Lys-Asp-His-Asp-Gly-Asp-Tyr-Lys-Asp-His-Asp-Ile-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-OH

علامة الببتيد الاصطناعية
GC30285 Eledoisin (Eledone peptide)

ELD 950, Moschatin
A neurokinin receptor agonist
GP10150 FLAG tag Peptide

H-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-OH

العلامة الوصفية FLAG هي ببتيد مكون من 8 أحماض أمينية (أسبارتات- تيرول- ليسين- أسبارتات- أسبارتات- أسبارتات -أسبارتات - ليسين) يحتوي على موقع قيود كايلانز المعوية.
GC52376 BMP2-derived Peptide (trifluoroacetate salt)

Bone Morphogenic Protein 2-derived Peptide, KIPKASSVPTELSAISTLYL-NH2
A synthetic peptide
GC44655 PKCε Inhibitor Peptide

Protein Kinase Cɛ Inhibitor Peptide，ɛV1-2
PKCε ؛ المانع الببتيد (ε؛ -V1-2) ، PKCε ؛ الببتيد المشتق ، هو PKCε انتقائي ؛ المانع.
GC45382 Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt)

Aβ (1-28), Aβ28
GC91860 Glucose-dependent Insulinotropic Peptide (22-51) (human) (trifluoroacetate salt)

GIP (22-51),Gastric Inhibitory Peptide (22-51)
Glucose-dependent insulinotropic peptide (GIP) (22-51) is a pro-atherogenic 30-amino acid peptide corresponding to residues 22-51 of the GIP precursor protein proGIP that has been found in human plasma.
GC91854 RS Repeat Peptide (trifluoroacetate salt) RS repeat peptide is a serine/arginine-rich peptide substrate for CDC-like kinase 1 (Clk1).
GC91847 KEMPFPKYPVEP Peptide (bovine, ovine) (trifluoroacetate salt) KEMPFPKYPVEP Peptide is a peptide fragment of the dairy protein β-casein.
GC91835 Heparin-binding Peptide (trifluoroacetate salt)

Fibronectin Adhesion-promoting Peptide,Fibronectin Peptide V,FN-C/H-V
Heparin-binding peptide is a synthetic peptide fragment corresponding to residues 1,892-1,899 of the C-terminal heparin-binding domain of fibronectin.
GP10091 Vasonatrin Peptide (1-27)

H2N-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH
Vasonatrin Peptide (1-27), (C124H198N36O36S3), a peptide with the sequence H2N-GLSKGCFGLKLDRIGSMSGLGCNSFRY-OH, MW= 2865.4.
GP10049 Amyloid Beta-Peptide (12-28) (human) Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)).
GP10082 Amyloid Beta-peptide (25-35) (human)
الببتيد بيتا الأميلويد (25-35) (الإنسان) هو جزء من ببتيد أميلويد بيتا في مرض الزهايمر وله تأثيرات عصبية سامة.
GC52385 Myelin Basic Protein (85-99) Peptide Antagonist (trifluoroacetate salt)

EKPKVEAYKAAAAPA-OH, MBP (85-99) Peptide Antagonist
An MBP (85-99) antagonist
GC66061 Competence-Stimulating Peptide-2 (CSP-2) الببتيد المحفز للكفاءة -2 (CSP-2) هو ببتيد إشارة لاستشعار النصاب تنتجه Streptococcus pneumoniae. ComD2 هو مستقبل متوافق مع الببتيد المحفز للكفاءة -2 (CSP-2) بقيمة EC50 تبلغ 50.7 نانومتر.
GC91844 [pGlu4]-Myelin Basic Protein Peptide (trifluoroacetate salt)

pGlu4-MBP Peptide
[pGlu]-Myelin basic protein peptide is a substrate for PKC.
GC70187 δ-Sleep Inducing Peptide acetate

Delta-Sleep Inducing Peptide acetate

δ-Sleep Inducing Peptide acetate هو نوع من الببتيدات العصبية ، وله تأثير مضاد للأكسدة ومضاد للاضطراب.
GC52361 AMARA Peptide (trifluoroacetate salt)

AMARAASAAALARRR-OH, H-Ala-Met-Ala-Arg-Ala-Ala-Ser-Ala-Ala-Ala-Leu-Ala-Arg-Arg-Arg-OH
A peptide substrate for AMPK
GC52196 RGD Peptide

GRGDNP, HGlyArgGlyAspAsnProOH
يعمل RGD Peptide كمثبط لتفاعلات الإنتجرين - يجند ويلعب دورًا مهمًا في التصاق الخلية ، والهجرة ، والنمو ، والتمايز.
GC49883 DAPK Substrate Peptide (trifluoroacetate salt)

Death-associated Protein Kinase Substrate Peptide
A DAPK1 peptide substrate
GC48346 DYKDDDDK Peptide (trifluoroacetate salt)

DYKDDDDK Epitope, DYKDDDDK Octapeptide, DYKDDDDK Tag
GC37524 RGD peptide (GRGDNP) TFA
GC44806 Ras Inhibitory Peptide

Sos SH3 Domain Inhibitor
Son of sevenless homolog 1 (Sos1) is a guanine nucleotide exchange factor (GEF) that directs the exchange of Ras-GDP to Ras-GTP by binding to SH3 domains of the growth factor receptor-bound protein 2 (Grb2), leading to the activation of ERK.
GC34274 SPACE peptide ببتيد الفضاء هو ببتيد مخترق للجلد (SPPs)
GC91470 Fyn Peptide (410-430) (human, mouse, rat, porcine, bovine) (trifluoroacetate salt)

Src (409-429) (human, rat); Src (408-428) (mouse)

يعد ببتيد Fyn (410-430) جزءًا من فراغمة الصفائح البروتينية ذات التروسانيل كيناز غير المستقبل للتايروزين Fyn والذي يحتوي على Tyr420، والذي يخضع للأوتوفسفرة عند تنشط Fyn بالكامل.
GC91462 Abl Substrate Peptide (trifluoroacetate salt)
الببتيد الأساسي للمادة الفعالة Abl هو ببتيد فعال يستخدم كمادة أساسية لإنزيم التايروزين كيناز Abl.
GC91441 RGD Peptide (trifluoroacetate salt)

GRGDNP; H-Gly-Arg-Gly-Asp-Asn-Pro-OH

الببتيد RGD هو مركب اصطناعي يتألف من نمط الأرجينين-الجلايسين-الاسبارتات وقد استخدم بشكل واسع لتثبيط تفاعلات الانتقالية المستضافة في دراسات تتعلق بالإلتصاق الخلوي، التحرك، النمو و التمايز.
GC91027 EGFRvIII Peptide (trifluoroacetate salt)
جزء ببتيد من EGFRvIII
GC90733 Klotho-derived Peptide 1 (56-87) (human) (trifluoroacetate salt)
ببتيد يعطل TGF-β
GC90635 RAD17-derived Peptide (trifluoroacetate salt)
مادة فسفتيدية للأنزيم ATR
GC90620 N-Peptide (trifluoroacetate salt)
ببتيد
GC90600 Tat-NTS Peptide (trifluoroacetate salt)
ببتيد يخترق الخلية
GC90561 Gastric Inhibitory Peptide (22-51) (human) (trifluoroacetate salt)
ببتيد محفز لتكون الدهون في الشرايين
GC90558 Myelin Basic Protein Peptide Antagonist (trifluoroacetate salt)
مضاد للـ MBP
GC90547 Gastric Inhibitory Peptide 1 (3-42) (human) (trifluoroacetate salt)
جزء ببتيد من GIP ومضاد لمستقبل GIP
GC90546 MOG Peptide (human, bovine) (acetate)
ببتيد غلاف الأعصاب الميلينية الذاتي التكوين
GC90543 EGFR Peptide (human, mouse) (myristoylated) (trifluoroacetate salt)
مثبط PKC
GC90542 EGFR Peptide (human, mouse) (trifluoroacetate salt)
مادة فعالة ببتيدية ل PKC
GC90534 Gastric Inhibitory Peptide (1-39) (porcine) (trifluoroacetate salt)
محفز لإفراز الأنسولين
GC90529 Myelin Basic Protein Peptide (mouse, bovine) (trifluoroacetate salt)
مادة فعالة ببتيدية ل PKC
GC90286 Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt)
جزء بروتيني من الأميلويد-بي يحتوي على 28 رائدًا.
GC17195 Bax inhibitor peptide V5

BIP-V5; BAX Inhibiting Peptide V5
A Bax inhibitor
GP10104 S6 Kinase Substrate Peptide 32

H2N-Lys-Glu-Ala-Lys-Glu-Lys-Arg-Gln-Glu-Gln-Ile-Ala-Lys-Arg-Arg-Arg-Leu-Ser-Ser-Leu-Arg-Ala-Ser-Thr-Ser-Lys-Ser-Gly-Gly-Ser-Gln-Lys-OH
Measures the activity of kinases that phosphorylate ribosomal protein S6.
GP10108 EGF-R (661-681) T669 Peptide

H2N-Lys-Arg-Glu-Leu-Val-Glu-Pro-Leu-Thr-Pro-Ser-Gly-Glu-Ala-Pro-Asn-Gln-Ala-Leu-Leu-Arg-OH
GP10011 Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell

Ac-Pro-Tyr-Asn-Ser-Ser-Pro-Arg-Pro-Glu-Gln-His-Lys-Ser-Tyr-Lys-Cys-OH
GP10098 Cdk2/Cyclin Inhibitory Peptide I

H2N-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Pro-Val-Lys-Arg-Arg-Leu-Phe-Gly-OH
GP10094 Amyloid β-peptide (10-35), amide

H2N-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-NH2
GP10147 Ribosomal protein L3 peptide (202-222) amide

H2N-Met-Ser-His-Arg-Lys-Tyr-Glu-Ala-Pro-Arg-His-Gly-His-Leu-Gly-Phe-Leu-Pro-Arg-Lys-Arg-amide
GP10042 Rhodopsin peptide

H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH
GP10127 Cadherin Peptide, avian

H2N-Leu-Arg-Ala-His-Ala-Val-Asp-Val-Asn-Gly-amide

Role in cell adhesion
GP10095 Epidermal Growth Factor Receptor Peptide (985-996)

H2N-Asp-Val-Val-Asp-Ala-Asp-Glu-Tyr-Leu-Ile-Pro-Gln-OH
GP10089 Platelet Membrane Glycoprotein IIB Peptide (296-306)

H2N-Thr-Asp-Val-Asn-Gly-Asp-Gly-Arg-His-Asp-Leu-OH

Inhibits platelet aggregation
GP10046 Amyloid Precursor C-Terminal Peptide

H2N-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH

For beta amyloid generation
GP10118 Amyloid Beta-Peptide (1-40) (human)
ببتيد أميلويد بيتا (1-40) (الإنسان)، (C194H295N53O58S1)، وهو ببتيد يحتوي على التسلسل H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH، الكتلة الجزيئية = 4329.8. يعد أميلويد بيتا (Aβ أو Abeta) من الببتيدات المكونة لـ 36-43 حمضًا أمينية والذي يُصَنَّع من بروتين مُستَخِرِج الأميلود.
GP10022 Dynamin inhibitory peptide

Gln-Val-Pro-Ser-Arg-Pro-Asn-Arg-Ala-Pro
GP10057 Amyloid β-Peptide (10-20) (human)

Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe
GA21428 Erythropoietin Mimetic Peptide Sequence 20 Peptide mimetic of erythropoietin (EPO). EMP-20 has been described to be an excellent starting point for the design of compounds with erythropoietin (EPO) mimetic activity and can serve as a minimal model for an EPO receptor antagonist.
GC38520 PTD-p65-P1 Peptide TFA PTD-p65-P1 Peptide TFA هو عامل نسخ نووي انتقائي فعال مثبط NF-B ويستمد من الوحدة الفرعية p65 لبقايا الأحماض الأمينية NF-κB 271-282 ، والتي تمنع بشكل انتقائي تنشيط NF-B الناجم عن التحفيز الالتهابي المختلف ، أسفل - تنظيم التعبير الجيني بوساطة NF- κB وتنظيم موت الخلايا المبرمج
GC62069 pm26TGF-β1 peptide TFA
GC62068 pm26TGF-β1 peptide
GC64248 c-Myc Peptide TFA c-Myc Peptide (TFA) هو ببتيد صناعي يتوافق مع الأحماض الأمينية C- الطرفية (410-419) لبروتين c-myc البشري ، ويشارك في تنظيم نسخ الجينات المرتبطة بالنمو
GC63708 Uty HY Peptide (246-254) (TFA) Uty HY Peptide (246-254) TFA ، المشتق من جين تكرار رباعي الببتيد المنسوخ في كل مكان على بروتين كروموسوم Y (UTY) باعتباره حاتمة HY ، H-YDb ، هو مستضد زرع خاص بالذكور H-Y
GC63447 C-Type Natriuretic Peptide (CNP) (1-22), human TFA C-Type Natriuretic Peptide (CNP) (1-22) ، الإنسان (TFA) ، جزء 1-22 من CNP ، هو ناهض مستقبلات الببتيد الناتريوتريك B (NPR-B)
GC61375 VSV-G tag Peptide VSV-G Peptide عبارة عن 11 ببتيد حمض أميني مشتق من بروتين سكري فيروسي لالتهاب الفم الحويصلي
GC36041 Fibronectin Adhesion-promoting Peptide

Heparin Binding Peptide
"الببتيد المعزز لالتصاق الفايبرونيكتين" هو محفز فعال لألياف الجهد والتركيز الفوكالي في الفيبروبلاست، والتي تشارك في تكوين الجلطات المتعلقة بالأمراض مثل الأمراض القلبية والأوعية الدموية الدهنية."
GC34266 OVA Peptide 323-339 OVA Peptide (323-339) يمثل حاتمة خلية T و B من Ovalbumin (Ova) ، وهو أمر مهم في توليد وتطوير استجابات فرط الحساسية الفورية في الفئران BALB / c
GC34023 Atrial Natriuretic Peptide (ANP) (1-28), human, porcine

ANF, ANP, Atrial Natriuretic Factor, α-Atriopeptin (human)
الببتيد الأذيني الطبيعي (ANP) (1-28) ، الإنسان ، الخنازير (Atrial Natriuretic Peptide (ANP) (1-28) ، الإنسان ، الخنازير) هو هرمون 28 من الأحماض الأمينية ، يتم إنتاجه وإفرازه بشكل طبيعي بواسطة قلب الإنسان استجابة لإصابة القلب والتمدد الميكانيكي.
GC33600 OVA Peptide (257-264) TFA

Ser-Ile-Ile-Asn-Phe-Glu-Lys-Leu, SIINFEKL, OVA (257-264)
OVA Peptide (257-264) TFA عبارة عن حاتمة ببتيد مقيد من الفئة I (Kb) لـ OVA ، يمكن أن يكون الببتيد الثماني من الألبومين البيضاوي الذي يقدمه جزيء الفئة I MHC ، H-2Kb.
GC33599 PAR-4 Agonist Peptide, amide TFA (PAR-4-AP (TFA))

PAR-4-AP TFA; AY-NH2 TFA
PAR-4 Agonist Peptide ، amide TFA (PAR-4-AP (TFA)) (PAR-4-AP TFA ؛ AY-NH2 TFA) عبارة عن ناهض لمستقبلات تنشيط البروتين -4 (PAR-4) ، وليس له أي تأثير على PAR-1 أو PAR-2 والتي يتم حظر تأثيراتها بواسطة مضاد PAR-4.
GC33585 β-catenin peptide &beta ؛ -Catenin peptide عبارة عن ببتيد 8-aa ، ويمكن أن يعزز الاختيار الإيجابي للخلايا التوتية.
GC33448 OVA Peptide 257-264 OVA Peptide 257-264 عبارة عن حاتمة ببتيد مقيد من الفئة الأولى لـ OVA ، يمكن أن يكون الببتيد الثماني من الألبومين البيضاوي الذي يقدمه جزيء الفئة I MHC ، H-2Kb.
GC26392 MANS peptide TFA
MANS peptide TFA is the TFA salt form of MANS peptide. MANS peptide TFA is an inhibitor of MARCKS, which competitively binds to MARCKS on the cell membrane, thereby inhibiting mucin secretion and tumor metastasis.
GC68908 C-Type Natriuretic Peptide (1-53), human TFA
C-Type Natriuretic Peptide (1-53)، TFA البشري هو جزء من ببتيد C-Type Natriuretic Peptide 1-53. ينتمي C-Type Natriuretic Peptide TFA إلى عائلة الببتيدات المسكِّنة للجهاز العصبي والذي يشارك في تحقيق التوازن بين الإلكترولايت والسوائل وضغط الأوعية الدموية.
GC35334 Amyloid β Peptide (42-1)(human) أميلويد β ؛ الببتيد (42-1) (الإنسان) هو الشكل غير النشط لأميلويد β ؛ الببتيد (1-42).

منتجات لـالقسم