Search Site
  • 0
    سلة التسوق

    انقر هنا لمعرفة عدد العناصر التي أضفتها:)

    image loader

    إضافة عنصر (عناصر) إلى سلة التسوق ......

الصفحة الرئيسية >> نتائج البحث عن: 'Peptide'
القسم: Caspase Aminopeptidase ACE Cathepsin HCV Protease MMP Thrombin Other Proteases Endogenous Metabolite Mitochondrial Metabolism PAI-1 Bax Bcl-2 Family TNF-α Other Apoptosis Histone Demethylases Histone Methyltransferase Citrullination Histones/Histone Peptides Neuronal Metabolism Bone Growth & Remodeling Carbohydrate Metabolism Cofactors & Vitamins Dyslipidemias Necrosis Nutrient Sensing Reproductive Biology PKA p38 JNK cAMP Broad Spectrum Protein Kinase Inhibitor Src Trk DNA/RNA Synthesis AMPK GSK-3 S6 Kinase Antibiotic HCV HIV Influenza virus Antifungal Bacterial Fungal Parasite Antiviral Microtubule/Tubulin Dynamin ECM & Adhesion Molecules Endomembrane System & Vesicular Trafficking Proteolysis Cytoskeleton & Motor Proteins Autophagy STAT PKC Integrin PAR1 Neuropeptide FF/AF Receptors Formyl Peptide Receptors 5-HT Receptor Adrenergic Receptor Apelin Receptor Angiotensin Receptor Bombesin Receptors Bradykinin Receptors Calcitonin and Related Receptors Cannabinoid Receptor CaSR CCR Chemokine Receptors Endothelin Receptor Galanin Receptors Ghrelin Receptors GIP Receptor Glucagon Receptor Melanocortin (MC) Receptors Motilin Receptor Non-selective CRF Neurotensin Receptors NOP Receptor NPY Receptors Oxytocin Receptors Peptide Receptors Protease-Activated Receptors Secretin Receptors Urotensin-II Receptor VIP Receptors Neuromedin U Receptors mAChR Neurokinin Receptor YAP AMPAR Calcium Channel Pannexin-1 TRP Channel Kainate Receptors Na+/K+ ATPase Cancer Biology Peptides Tumor Microenvironment Cell Migration & Metastasis GnRH Opioid Receptor Thyroid hormone Receptor TRH Glucocorticoids & Mineralocorticoids AChR Alzheimer Amyloid β CGRP DAPK Gap Junction GluR Histamine Receptor Neuroscience Peptides CaMK Behavioral Neuroscience Neuroendocrinology Neuroprotection Ophthalmology Pain Research Diabetes NAFLD & NASH Obesity Other Signal Transduction Apoptosis NF-κB Complement System IFNAR STING Reactive Oxygen Species Glutathione Adaptive Immunity Allergy Arthritis Autoimmunity Gastric Disease Innate Immunity Pulmonary Diseases Acute Phase Reactants Arrhythmia Atherosclerosis Chronic Kidney Disease Coagulation & Hemostasis Diabetic Nephropathy Endothelium Heart Failure Hypertension Myocardial Contractility Myocardial Hypertrophy Myocardial Infarction Serum Proteins Smooth Muscle Cells Stroke Thrombosis Vasoconstriction Vasodilation Antioxidants Carbohydrate Oxidation Lipid Peroxidation Pro-Oxidant Activity Adenylate cyclase Cell Penetrating Peptide Cytokine Enzyme Substrates / Activators Fluorescent Probes Glycoprotein Guanylate Cyclase MDR multidrug resistance Myosin Natriuretic Peptide Receptors Nitric Oxide Renin Tachykinin Transcription Factors Others Cyclase Negative Controls Toxicology Antiparasitics Peptide Coupling Reagents Amino Acids and Derivatives Natural Products Cyanine Dyes Dyes, Stains & Indicators Enzyme Substrates Fluorescence Biochemical Assay Reagents Tag Peptides Amyloid β protein Neuropeptides Peptide Hormones Dengue Yellow Fever Food-Borne Illnesses MRSA Pneumonia Tuberculosis Candidiasis Parasitic Diseases Quorum Sensing Macrophage Migration Inhibitory Factor Superoxide Dismutase
  1. القط. رقم اسم المنتج بيانات
  2. GC31523 Peptide YY (PYY) (3-36), human (Peptide YY (3-36)) الببتيد YY (PYY) (3-36) ، الإنسان (الببتيد YY (3-36)) هو هرمون الأمعاء الذي يعمل كمحفز لمستقبل Y2 لتقليل الشهية. Peptide YY (PYY) (3-36), human (Peptide YY (3-36)) Chemical Structure
  3. GC44598 Peptide YY (human) (trifluoroacetate salt)

    Peptide YY (PYY) is a 36-amino acid peptide and anorectic gut hormone agonist for the neuropeptide Y receptors Y1, Y2, Y5, and Y6 with EC50 values of 0.7, 0.58, 1, and 0.8 nM, respectively, for supression of forskolin-induced cAMP accumulation.

     Peptide YY (human) (trifluoroacetate salt) Chemical Structure
  4. GC63855 Peptide YY (PYY) (3-36), porcine TFA الببتيد YY (PYY) (3-36) ، TFA هو هرمون الأمعاء الذي يعمل كمحفز لمستقبل Y2 لتقليل الشهية Peptide YY (PYY) (3-36), porcine TFA Chemical Structure
  5. GC36874 Peptide YY (PYY) (3-36), human TFA Peptide YY (PYY) (3-36), human TFA Chemical Structure
  6. GC63141 Peptide 74 الببتيد 74 عبارة عن ببتيد اصطناعي يحتوي على تسلسل أولي لمصفوفة البروتين المعدني (MMP). يثبط الببتيد 74 الشكل المنشط لكولاجيناز من النوع الرابع 72 كيلو دالتون في المختبر. Peptide 74 Chemical Structure
  7. GC32335 Peptide T TFA الببتيد T (TFA) هو octapeptide من منطقة V2 من HIV-1 gp120 Peptide T TFA Chemical Structure
  8. GC32309 Peptide T الببتيد T هو ثماني ببتيد من منطقة V2 من HIV-1 gp120 Peptide T Chemical Structure
  9. GC31767 Peptide 401 الببتيد 401 ، عامل تحبيب قوي للخلايا البدينة من سم النحل ، يمنع زيادة نفاذية الأوعية الدموية بسبب الحقن داخل الأدمة للعديد من مسببات التشنج العضلي الملساء (الهيستامين ، و 5-HT) Peptide 401 Chemical Structure
  10. GP10131 Peptide YY(3-36), PYY, human Peptide YY(3-36), PYY, human Chemical Structure
  11. GC36873 Peptide C105Y الببتيد C105Y ، ببتيد صناعي مخترق للخلايا يعتمد على تسلسل الأحماض الأمينية المطابقة للمخلفات 359-374 من α1-antitrypsin ، يعزز التعبير الجيني من جزيئات الحمض النووي النانوية Peptide C105Y Chemical Structure
  12. GC52502 Peptide YY (3-36) (trifluoroacetate salt) A satiety hormone Peptide YY (3-36) (trifluoroacetate salt) Chemical Structure
  13. GA23355 Peptide Lv (rat) Peptide Lv has been discovered via a computational bioinformatics-based screening process. The neuropeptide is expressed in retinal photoreceptor layer, hippocampus, olfactory bulb, cerebellum, cerebral cortex, lung, spleen, liver and intestine. Peptide Lv enhances L-type voltage-gated calcium channel (L-VGCC) currents in retinal photoreceptors. Peptide Lv (rat) Chemical Structure
  14. GC63347 Peptide 78 الببتيد 78 ، وهو سيتوكين كيميائي ، وهو عبارة عن 78 بروتين من الأحماض الأمينية من عائلة الجينات الكيميائية العملاقة IL-8 أو CX-C Peptide 78 Chemical Structure
  15. GC30452 Peptide YY (PYY), human الببتيد YY (PYY) هو هرمون الأمعاء الذي ينظم الشهية ويمنع إفراز البنكرياس Peptide YY (PYY), human Chemical Structure
  16. GC50439 Peptide5 Peptide5 ، كونيكسين 43 ببتيد مقلد ، يقلل من تورم الحيوانات ، وداء نجمي ، وموت الخلايا العصبية بعد إصابة الحبل الشوكي في المختبر: الببتيد 5 ، يقلل بشكل كبير من درجة إصابة الحبل الشوكي (SCI) في نموذج القوارض خارج الجسم الحي Peptide5 Chemical Structure
  17. GC30233 Peptide M الببتيد M هو حمض أميني صناعي (18 حمضًا أمينيًا في الطول يتوافق مع مواضع الأحماض الأمينية 303-322 من مستضد الأبقار: DTNLASSTIIKEGIDKTV) ، قادر على إحداث التهاب القزحية المناعي الذاتي التجريبي في القرود وخنازير هارتلي غينيا وكذلك فئران لويس Peptide M Chemical Structure
  18. GA23356 Peptide WE-14 WE-14, a chromogranin A-derived peptide, was isolated from a human ileal carcinoid tumor. Its sequence WSKMDQLAKELTAE is highly conserved in many mammalian species and flanked by typical processing sites. Such factors would indicate a potential physiological role for peptide WE-14. Peptide WE-14 Chemical Structure
  19. GA23357 Peptide YY (13-36) (canine, mouse, porcine, rat) This C-terminal fragment was shown to suppress the noradrenaline release from sympathetic nerve endings. It thereby mimics the effects of PYY and NPY at presynaptic (Y?) receptors. The peptide was also able to compete with NPY for essentially all binding sites in rat brain. Peptide YY (13-36) (canine, mouse, porcine, rat) Chemical Structure
  20. GA23358 Peptide YY (canine, mouse, porcine, rat) Peptide YY (canine, mouse, porcine, rat) Chemical Structure
  21. GC30535 Transdermal Peptide (TD 1 (peptide)) Transdermal Peptide (TD 1 (peptide)), consisting of 11 amino acids, is the first transdermal enhancing peptide discovered by phage display. Transdermal Peptide (TD 1 (peptide)) Chemical Structure
  22. GC31527 C-Peptide, dog (C-Peptide (dog)) C-Peptide ، كلب (C-Peptide (كلب)) هو أحد مكونات proinsulin ، يتم إطلاقه من خلايا بيتا البنكرياس في الدم مع الأنسولين. C-Peptide, dog (C-Peptide (dog)) Chemical Structure
  23. GC31172 δ-Sleep Inducing Peptide (Delta-Sleep Inducing Peptide) &delta ؛ - الببتيد المحفز للنوم (الببتيد الذي يحفز النوم) عبارة عن ببتيد عصبي ، مع خصائص مضادة للأكسدة ومزيل للقلق. δ-Sleep Inducing Peptide (Delta-Sleep Inducing Peptide) Chemical Structure
  24. GC35123 3X FLAG peptide TFA 3X FLAG peptide TFA Chemical Structure
  25. GC34397 Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) الببتيد الصناعي Sphistin (12-38 ، Fitc في N-Terminal-Fluorescently Labeled Peptide) عبارة عن شظايا مقطوعة من الببتيد الاصطناعي Sphistin الذي يُظهر نشاطًا قويًا مضادًا للميكروبات Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) Chemical Structure
  26. GP10149 3X FLAG Peptide

    علامة الببتيد الاصطناعية

     3X FLAG Peptide Chemical Structure
  27. GC30285 Eledoisin (Eledone peptide) A neurokinin receptor agonist Eledoisin (Eledone peptide) Chemical Structure
  28. GP10118 Amyloid Beta-Peptide (1-40) (human)

    ببتيد أميلويد بيتا (1-40) (الإنسان)، (C194H295N53O58S1)، وهو ببتيد يحتوي على التسلسل H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH، الكتلة الجزيئية = 4329.8. يعد أميلويد بيتا (Aβ أو Abeta) من الببتيدات المكونة لـ 36-43 حمضًا أمينية والذي يُصَنَّع من بروتين مُستَخِرِج الأميلود.

     Amyloid Beta-Peptide (1-40) (human) Chemical Structure
  29. GC52376 BMP2-derived Peptide (trifluoroacetate salt) A synthetic peptide BMP2-derived Peptide (trifluoroacetate salt) Chemical Structure
  30. GC45382 Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt)   Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt) Chemical Structure
  31. GC44655 PKCε Inhibitor Peptide PKCε ؛ المانع الببتيد (ε؛ -V1-2) ، PKCε ؛ الببتيد المشتق ، هو PKCε انتقائي ؛ المانع. PKCε Inhibitor Peptide Chemical Structure
  32. GP10091 Vasonatrin Peptide (1-27) Vasonatrin Peptide (1-27), (C124H198N36O36S3), a peptide with the sequence H2N-GLSKGCFGLKLDRIGSMSGLGCNSFRY-OH, MW= 2865.4. Vasonatrin Peptide (1-27) Chemical Structure
  33. GP10049 Amyloid Beta-Peptide (12-28) (human)

    Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)).

     Amyloid Beta-Peptide (12-28) (human) Chemical Structure
  34. GP10082 Amyloid Beta-peptide (25-35) (human)

    الببتيد بيتا الأميلويد (25-35) (الإنسان) هو جزء من ببتيد أميلويد بيتا في مرض الزهايمر وله تأثيرات عصبية سامة.

     Amyloid Beta-peptide (25-35) (human) Chemical Structure
  35. GC52385 Myelin Basic Protein (85-99) Peptide Antagonist (trifluoroacetate salt) An MBP (85-99) antagonist Myelin Basic Protein (85-99) Peptide Antagonist (trifluoroacetate salt) Chemical Structure
  36. GC66061 Competence-Stimulating Peptide-2 (CSP-2) الببتيد المحفز للكفاءة -2 (CSP-2) هو ببتيد إشارة لاستشعار النصاب تنتجه Streptococcus pneumoniae. ComD2 هو مستقبل متوافق مع الببتيد المحفز للكفاءة -2 (CSP-2) بقيمة EC50 تبلغ 50.7 نانومتر. Competence-Stimulating Peptide-2 (CSP-2) Chemical Structure
  37. GC70187 δ-Sleep Inducing Peptide acetate

    δ-Sleep Inducing Peptide acetate هو نوع من الببتيدات العصبية ، وله تأثير مضاد للأكسدة ومضاد للاضطراب.

     δ-Sleep Inducing Peptide acetate Chemical Structure
  38. GC52361 AMARA Peptide (trifluoroacetate salt) A peptide substrate for AMPK AMARA Peptide (trifluoroacetate salt) Chemical Structure
  39. GC52196 RGD Peptide يعمل RGD Peptide كمثبط لتفاعلات الإنتجرين - يجند ويلعب دورًا مهمًا في التصاق الخلية ، والهجرة ، والنمو ، والتمايز. RGD Peptide Chemical Structure
  40. GC49883 DAPK Substrate Peptide (trifluoroacetate salt) A DAPK1 peptide substrate DAPK Substrate Peptide (trifluoroacetate salt) Chemical Structure
  41. GC48346 DYKDDDDK Peptide (trifluoroacetate salt) DYKDDDDK Peptide (trifluoroacetate salt) Chemical Structure
  42. GC37524 RGD peptide (GRGDNP) TFA RGD peptide (GRGDNP) TFA Chemical Structure
  43. GC44806 Ras Inhibitory Peptide Son of sevenless homolog 1 (Sos1) is a guanine nucleotide exchange factor (GEF) that directs the exchange of Ras-GDP to Ras-GTP by binding to SH3 domains of the growth factor receptor-bound protein 2 (Grb2), leading to the activation of ERK. Ras Inhibitory Peptide Chemical Structure
  44. GC34274 SPACE peptide ببتيد الفضاء هو ببتيد مخترق للجلد (SPPs) SPACE peptide Chemical Structure
  45. GP10150 FLAG tag Peptide

    العلامة الوصفية FLAG هي ببتيد مكون من 8 أحماض أمينية (أسبارتات- تيرول- ليسين- أسبارتات- أسبارتات- أسبارتات -أسبارتات - ليسين) يحتوي على موقع قيود كايلانز المعوية.

     FLAG tag Peptide Chemical Structure
  46. GP10104 S6 Kinase Substrate Peptide 32 Measures the activity of kinases that phosphorylate ribosomal protein S6. S6 Kinase Substrate Peptide 32 Chemical Structure
  47. GP10108 EGF-R (661-681) T669 Peptide EGF-R (661-681) T669 Peptide Chemical Structure
  48. GP10011 Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell Chemical Structure
  49. GP10098 Cdk2/Cyclin Inhibitory Peptide I Cdk2/Cyclin Inhibitory Peptide I Chemical Structure
  50. GP10094 Amyloid β-peptide (10-35), amide Amyloid β-peptide (10-35), amide Chemical Structure
  51. GP10147 Ribosomal protein L3 peptide (202-222) amide Ribosomal protein L3 peptide (202-222) amide Chemical Structure
  52. GP10042 Rhodopsin peptide Rhodopsin peptide Chemical Structure
  53. GP10127 Cadherin Peptide, avian

    Role in cell adhesion

     Cadherin Peptide, avian Chemical Structure
  54. GP10095 Epidermal Growth Factor Receptor Peptide (985-996) Epidermal Growth Factor Receptor Peptide (985-996) Chemical Structure
  55. GP10043 GnRH Associated Peptide (GAP) (1-13), human

    Inhibitor of prolactin secretion

     GnRH Associated Peptide (GAP) (1-13), human Chemical Structure
  56. GP10089 Platelet Membrane Glycoprotein IIB Peptide (296-306)

    Inhibits platelet aggregation

     Platelet Membrane Glycoprotein IIB Peptide (296-306) Chemical Structure
  57. GP10046 Amyloid Precursor C-Terminal Peptide

    For beta amyloid generation

     Amyloid Precursor C-Terminal Peptide Chemical Structure
  58. GP10022 Dynamin inhibitory peptide Dynamin inhibitory peptide Chemical Structure
  59. GP10057 Amyloid β-Peptide (10-20) (human) Amyloid β-Peptide (10-20) (human) Chemical Structure
  60. GA21428 Erythropoietin Mimetic Peptide Sequence 20 Peptide mimetic of erythropoietin (EPO). EMP-20 has been described to be an excellent starting point for the design of compounds with erythropoietin (EPO) mimetic activity and can serve as a minimal model for an EPO receptor antagonist. Erythropoietin Mimetic Peptide Sequence 20 Chemical Structure
  61. GP10152 Influenza Hemagglutinin (HA) Peptide

    ببتيد

     Influenza Hemagglutinin (HA) Peptide Chemical Structure
  62. GC38520 PTD-p65-P1 Peptide TFA PTD-p65-P1 Peptide TFA هو عامل نسخ نووي انتقائي فعال مثبط NF-B ويستمد من الوحدة الفرعية p65 لبقايا الأحماض الأمينية NF-κB 271-282 ، والتي تمنع بشكل انتقائي تنشيط NF-B الناجم عن التحفيز الالتهابي المختلف ، أسفل - تنظيم التعبير الجيني بوساطة NF- κB وتنظيم موت الخلايا المبرمج PTD-p65-P1 Peptide TFA Chemical Structure
  63. GC62069 pm26TGF-β1 peptide TFA pm26TGF-β1 peptide TFA Chemical Structure
  64. GC62068 pm26TGF-β1 peptide pm26TGF-β1 peptide Chemical Structure
  65. GC68908 C-Type Natriuretic Peptide (1-53), human TFA

    C-Type Natriuretic Peptide (1-53)، TFA البشري هو جزء من ببتيد C-Type Natriuretic Peptide 1-53. ينتمي C-Type Natriuretic Peptide TFA إلى عائلة الببتيدات المسكِّنة للجهاز العصبي والذي يشارك في تحقيق التوازن بين الإلكترولايت والسوائل وضغط الأوعية الدموية.

     C-Type Natriuretic Peptide (1-53), human TFA Chemical Structure
  66. GC64248 c-Myc Peptide TFA c-Myc Peptide (TFA) هو ببتيد صناعي يتوافق مع الأحماض الأمينية C- الطرفية (410-419) لبروتين c-myc البشري ، ويشارك في تنظيم نسخ الجينات المرتبطة بالنمو c-Myc Peptide TFA Chemical Structure
  67. GC63708 Uty HY Peptide (246-254) (TFA) Uty HY Peptide (246-254) TFA ، المشتق من جين تكرار رباعي الببتيد المنسوخ في كل مكان على بروتين كروموسوم Y (UTY) باعتباره حاتمة HY ، H-YDb ، هو مستضد زرع خاص بالذكور H-Y Uty HY Peptide (246-254) (TFA) Chemical Structure
  68. GC63447 C-Type Natriuretic Peptide (CNP) (1-22), human TFA C-Type Natriuretic Peptide (CNP) (1-22) ، الإنسان (TFA) ، جزء 1-22 من CNP ، هو ناهض مستقبلات الببتيد الناتريوتريك B (NPR-B) C-Type Natriuretic Peptide (CNP) (1-22), human TFA Chemical Structure
  69. GC61375 VSV-G tag Peptide VSV-G Peptide عبارة عن 11 ببتيد حمض أميني مشتق من بروتين سكري فيروسي لالتهاب الفم الحويصلي VSV-G tag Peptide Chemical Structure
  70. GC36041 Fibronectin Adhesion-promoting Peptide

    ببتيد تعزيز الالتصاق للفايبرونكتين هو محفز قوي لألياف الإجهاد والانطباع المركز في خلايا الألياف، التي تشارك في تشكيل جلطات الدم ذات صلة بالأمراض مثل أمراض القلب التصلبية.

     Fibronectin Adhesion-promoting Peptide Chemical Structure
  71. GC34266 OVA Peptide 323-339 OVA Peptide (323-339) يمثل حاتمة خلية T و B من Ovalbumin (Ova) ، وهو أمر مهم في توليد وتطوير استجابات فرط الحساسية الفورية في الفئران BALB / c OVA Peptide 323-339 Chemical Structure
  72. GC34023 Atrial Natriuretic Peptide (ANP) (1-28), human, porcine الببتيد الأذيني الطبيعي (ANP) (1-28) ، الإنسان ، الخنازير (Atrial Natriuretic Peptide (ANP) (1-28) ، الإنسان ، الخنازير) هو هرمون 28 من الأحماض الأمينية ، يتم إنتاجه وإفرازه بشكل طبيعي بواسطة قلب الإنسان استجابة لإصابة القلب والتمدد الميكانيكي. Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Chemical Structure
  73. GC33600 OVA Peptide (257-264) TFA OVA Peptide (257-264) TFA عبارة عن حاتمة ببتيد مقيد من الفئة I (Kb) لـ OVA ، يمكن أن يكون الببتيد الثماني من الألبومين البيضاوي الذي يقدمه جزيء الفئة I MHC ، H-2Kb. OVA Peptide (257-264) TFA Chemical Structure
  74. GC33599 PAR-4 Agonist Peptide, amide TFA (PAR-4-AP (TFA)) PAR-4 Agonist Peptide ، amide TFA (PAR-4-AP (TFA)) (PAR-4-AP TFA ؛ AY-NH2 TFA) عبارة عن ناهض لمستقبلات تنشيط البروتين -4 (PAR-4) ، وليس له أي تأثير على PAR-1 أو PAR-2 والتي يتم حظر تأثيراتها بواسطة مضاد PAR-4. PAR-4 Agonist Peptide, amide TFA (PAR-4-AP (TFA)) Chemical Structure
  75. GC33585 β-catenin peptide &beta ؛ -Catenin peptide عبارة عن ببتيد 8-aa ، ويمكن أن يعزز الاختيار الإيجابي للخلايا التوتية. β-catenin peptide Chemical Structure
  76. GC33448 OVA Peptide 257-264 OVA Peptide 257-264 عبارة عن حاتمة ببتيد مقيد من الفئة الأولى لـ OVA ، يمكن أن يكون الببتيد الثماني من الألبومين البيضاوي الذي يقدمه جزيء الفئة I MHC ، H-2Kb. OVA Peptide 257-264 Chemical Structure
  77. GC64476 Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat acetate المايلين قليل التغصن الببتيد بروتين سكري (35-55) ، فأر ، فأر (MOG (35-55)) أسيتات هو مكون ثانوي من المايلين في الجهاز العصبي المركزي Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat acetate Chemical Structure
  78. GC63889 Proteasome-activating peptide 1 TFA الببتيد المنشط للبروتيازوم 1 TFA هو ببتيد ومنشط بروتيازوم قوي Proteasome-activating peptide 1 TFA Chemical Structure
  79. GC63766 G-Protein antagonist peptide TFA الببتيد المضاد للبروتين G الببتيد TFA هو مادة مبتورة مرتبطة بالببتيد P ، تتنافس مع مستقبلات الارتباط بالبروتين G G-Protein antagonist peptide TFA Chemical Structure
  80. GC60095 Brain Natriuretic Peptide (1-32), rat acetate الببتيد الطبيعي للمخ (1-32) ، أسيتات الفئران (BNP (1-32) ، أسيتات الجرذ) هو عبارة عن 32 ببتيد من الأحماض الأمينية تفرزها بطينات القلب استجابةً للتمدد المفرط لخلايا عضلة القلب (خلايا عضلة القلب) Brain Natriuretic Peptide (1-32), rat acetate Chemical Structure
  81. GC36893 Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa Phe-Met-Arg-Phe مثل الببتيد ، Snail Helix aspersa عبارة عن ببتيد يشبه FMRF من العضلات الحشوية والجسدية للحلزون Helix aspersa Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa Chemical Structure
  82. GC36670 Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat (TFA) Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat (TFA) Chemical Structure
  83. GC36467 LL-37 scrambled peptide الببتيد المخفوق LL-37 هو نسخة مخلوطة من الببتيد الكاثليسيدين المضاد للميكروبات LL-37 LL-37 scrambled peptide Chemical Structure
  84. GC36150 Glucagon-Like Peptide (GLP) I (7-36), amide, human الببتيد الشبيه بالجلوكاجون (GLP) I (7-36) ، أميد ، الإنسان هو هرمون إنكريتين فسيولوجي يحفز إفراز الأنسولين. Glucagon-Like Peptide (GLP) I (7-36), amide, human Chemical Structure
  85. GC35549 Brain Natriuretic Peptide (BNP) (1-32), rat TFA Brain Natriuretic Peptide (BNP) (1-32), rat TFA Chemical Structure
  86. GC35426 Atrial Natriuretic Peptide (ANP) (1-28), rat TFA الببتيد الأذيني الطبيعي (ANP) (1-28) ، الجرذ (TFA) هو شكل متداول رئيسي من ANP في الفئران ، ويثبط بشكل فعال إفراز endothelin-1 المحفز للأنجيوتنسين 2 بطريقة تعتمد على التركيز Atrial Natriuretic Peptide (ANP) (1-28), rat TFA Chemical Structure
  87. GC44654 PKCα (C2-4) Inhibitor Peptide The C2 domain of conventional PKC isoforms mediates calcium-dependent translocation. PKCα (C2-4) Inhibitor Peptide Chemical Structure
  88. GC42871 Atrial Natriuretic Peptide (1-28) (rat) (trifluoroacetate salt) Atrial natriuretic peptide (ANP) is an endogenous peptide generated by proteolysis of prepro-ANP that is secreted by cardiomyocytes in the heart. Atrial Natriuretic Peptide (1-28) (rat) (trifluoroacetate salt) Chemical Structure
  89. GC34400 c-Myc Peptide Trifluoroacetate c-Myc Peptide Trifluoroacetate Chemical Structure
  90. GC34396 Calcitonin Gene Related Peptide (CGRP) (83-119), rat Calcitonin Gene Related Peptide (CGRP) (83-119), rat Chemical Structure
  91. GC34395 Calcitonin Gene Related Peptide (CGRP) (83-119), rat TFA Calcitonin Gene Related Peptide (CGRP) (83-119), rat TFA Chemical Structure
  92. GC34233 PACAP-Related Peptide (PRP), human الببتيد المرتبط بـ PACAP (PRP) ، الإنسان عبارة عن منطقة 29 من الأحماض الأمينية من بروتين PACAP PACAP-Related Peptide (PRP), human Chemical Structure
  93. GC34025 Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate Atrial Natriuretic Peptide (ANP) (1-28) ، الإنسان ، خلات الخنازير (Atrial Natriuretic Peptide (ANP) (1-28) ، الإنسان ، أسيتات الخنازير) هو هرمون 28 من الأحماض الأمينية ، يتم إنتاجه وإفرازه بشكل طبيعي بواسطة قلب الإنسان استجابة لإصابة القلب والتمدد الميكانيكي. Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate Chemical Structure
  94. GC32612 BNP-45 rat (Brain natriuretic peptide-45 rat) فأر BNP-45 (جرذ ببتيد ناتريوتريك للدماغ -45 جرذ) (BNP-45 ، جرذ) هو شكل متداول من الببتيد الناتريوتريك في دماغ الجرذ المعزول من قلب الجرذان مع قوة فعالة خافضة للضغط ومغذية للصوديوم. BNP-45 rat (Brain natriuretic peptide-45 rat) Chemical Structure
  95. GC32589 Brain Natriuretic Peptide (BNP) (1-32), rat الببتيد الطبيعي للمخ (BNP) (1-32) ، الفئران (BNP (1-32) ، الجرذ) عبارة عن 32 ببتيد من الأحماض الأمينية تفرزها بطينات القلب استجابةً للتمدد المفرط لخلايا عضلة القلب (خلايا عضلة القلب). Brain Natriuretic Peptide (BNP) (1-32), rat Chemical Structure
  96. GC32299 Bombinin-Like Peptide BLP-1 الببتيد الشبيه بالبومبينين BLP-1 هو ببتيد مضاد للميكروبات من أنواع بومبينا. Bombinin-Like Peptide BLP-1 Chemical Structure
  97. GC15099 Autocamtide-2-related inhibitory peptide الببتيد المثبط المرتبط بـ Autocamtide-2 هو مثبط شديد التحديد وفعال لـ CaMKII مع IC 50 من 40 نانومتر Autocamtide-2-related inhibitory peptide Chemical Structure
  98. GP10151 c-Myc tag Peptide c-Myc tag Peptide Chemical Structure
  99. GP10112 TRH Precursor Peptide

    Thyrotropin Releasing Hormone Precursor Peptide

     TRH Precursor Peptide Chemical Structure
  100. GC52476 Bax Inhibitor Peptide V5 (trifluoroacetate salt) A Bax inhibitor Bax Inhibitor Peptide V5 (trifluoroacetate salt) Chemical Structure
  101. GC64246 V5 Epitope Tag Peptide TFA V5 Epitope Tag Peptide (TFA) عبارة عن علامة ببتيد مشتق من حاتمة صغيرة موجودة على بروتينات P و V للفيروس المخاطاني للفيروس القرد 5 V5 Epitope Tag Peptide TFA Chemical Structure

عناصر 1 إلى 100 من مجموع 1309

لكل صفحة
  1. 1
  2. 2
  3. 3
  4. 4
  5. 5

الصعود الى مجموعة التنبيه
تصفح عبر

منتجات لـالقسم

  1. Signaling Pathways450
    1. ....Proteases16
      1. ........Caspase1
      2. ........Aminopeptidase1
      3. ........ACE1
      4. ........Cathepsin1
      5. ........HCV Protease1
      6. ........MMP1
      7. ........Thrombin1
      8. ........Other Proteases1
      9. ........Endogenous Metabolite2
      10. ........Mitochondrial Metabolism3
      11. ........PAI-11
    2. ....Apoptosis26
      1. ........Bax3
      2. ........Bcl-2 Family4
      3. ........TNF-α3
      4. ........Other Apoptosis5
    3. ....Chromatin/Epigenetics14
      1. ........Histone Demethylases1
      2. ........Histone Methyltransferase1
      3. ........Citrullination6
      4. ........Histones/Histone Peptides6
    4. ....Metabolism27
      1. ........Aminopeptidase1
      2. ........Neuronal Metabolism1
      3. ........Bone Growth & Remodeling6
      4. ........Carbohydrate Metabolism2
      5. ........Cofactors & Vitamins1
      6. ........Dyslipidemias3
      7. ........Necrosis2
      8. ........Nutrient Sensing2
      9. ........Reproductive Biology7
    5. ....MAPK Signaling7
      1. ........PKA2
      2. ........p381
      3. ........JNK2
      4. ........cAMP1
    6. ....Tyrosine Kinase8
      1. ........Broad Spectrum Protein Kinase Inhibitor1
      2. ........Src3
      3. ........Trk1
    7. ....DNA Damage/DNA Repair3
      1. ........DNA/RNA Synthesis3
    8. ....PI3K/Akt/mTOR Signaling9
      1. ........AMPK2
      2. ........GSK-33
      3. ........S6 Kinase1
    9. ....Microbiology & Virology27
      1. ........Antibiotic10
      2. ........HCV2
      3. ........HIV6
      4. ........Influenza virus1
      5. ........Antifungal2
      6. ........Bacterial12
      7. ........Fungal1
      8. ........Parasite1
      9. ........Antiviral1
    10. ....Cell Cycle/Checkpoint31
      1. ........Microtubule/Tubulin2
      2. ........Dynamin1
      3. ........ECM & Adhesion Molecules12
      4. ........Endomembrane System & Vesicular Trafficking1
      5. ........Proteolysis8
      6. ........Cytoskeleton & Motor Proteins6
    11. ....Ubiquitination/ Proteasome4
      1. ........Autophagy3
    12. ....JAK/STAT Signaling2
      1. ........STAT2
    13. ....TGF-β / Smad Signaling2
      1. ........PKC2
    14. ....Angiogenesis15
      1. ........Integrin6
      2. ........PAR15
    15. ....GPCR/G protein83
      1. ........Neuropeptide FF/AF Receptors4
      2. ........Formyl Peptide Receptors10
      3. ........5-HT Receptor1
      4. ........Adrenergic Receptor2
      5. ........Apelin Receptor1
      6. ........Angiotensin Receptor8
      7. ........Bombesin Receptors6
      8. ........Bradykinin Receptors2
      9. ........Calcitonin and Related Receptors2
      10. ........Cannabinoid Receptor1
      11. ........CaSR1
      12. ........CCR1
      13. ........Chemokine Receptors1
      14. ........Endothelin Receptor5
      15. ........Galanin Receptors3
      16. ........Ghrelin Receptors1
      17. ........GIP Receptor1
      18. ........Glucagon Receptor9
      19. ........Melanocortin (MC) Receptors1
      20. ........Motilin Receptor1
      21. ........Non-selective CRF2
      22. ........Neurotensin Receptors2
      23. ........NOP Receptor3
      24. ........NPY Receptors1
      25. ........Oxytocin Receptors1
      26. ........Peptide Receptors2
      27. ........Protease-Activated Receptors4
      28. ........Secretin Receptors1
      29. ........Urotensin-II Receptor3
      30. ........VIP Receptors1
      31. ........Neuromedin U Receptors1
      32. ........mAChR2
      33. ........Neurokinin Receptor1
    16. ....Stem Cell5
      1. ........GSK-33
      2. ........YAP1
    17. ....Membrane Transporter/Ion Channel16
      1. ........AMPAR7
      2. ........Calcium Channel1
      3. ........Pannexin-12
      4. ........TRP Channel1
      5. ........Kainate Receptors1
      6. ........Na+/K+ ATPase3
    18. ....Cancer Biology35
      1. ........Cancer Biology Peptides12
      2. ........Tumor Microenvironment1
      3. ........Cell Migration & Metastasis3
    19. ....Endocrinology and Hormones50
      1. ........GnRH3
      2. ........Opioid Receptor7
      3. ........Thyroid hormone Receptor4
      4. ........TRH1
      5. ........Glucocorticoids & Mineralocorticoids1
    20. ....Neuroscience101
      1. ........5-HT Receptor1
      2. ........AChR1
      3. ........Alzheimer18
      4. ........Amyloid β13
      5. ........CGRP 3
      6. ........DAPK1
      7. ........Gap Junction3
      8. ........GluR1
      9. ........Histamine Receptor1
      10. ........Neuroscience Peptides12
      11. ........Neurokinin Receptor1
      12. ........CaMK3
      13. ........Behavioral Neuroscience19
      14. ........Neuroendocrinology11
      15. ........Neuroprotection7
      16. ........Ophthalmology7
      17. ........Pain Research15
    21. ....Obesity, Appetite Control & Diabetes21
      1. ........Diabetes13
      2. ........NAFLD & NASH3
      3. ........Obesity11
    22. ....Other Signal Transduction18
    23. ....Immunology/Inflammation77
      1. ........Apoptosis8
      2. ........NF-κB6
      3. ........Complement System2
      4. ........IFNAR1
      5. ........STING2
      6. ........Reactive Oxygen Species3
      7. ........Glutathione1
      8. ........Adaptive Immunity5
      9. ........Allergy2
      10. ........Arthritis1
      11. ........Autoimmunity16
      12. ........Gastric Disease1
      13. ........Innate Immunity26
      14. ........Pulmonary Diseases12
    24. ....Cardiovascular42
      1. ........Acute Phase Reactants1
      2. ........Arrhythmia6
      3. ........Atherosclerosis1
      4. ........Chronic Kidney Disease1
      5. ........Coagulation & Hemostasis5
      6. ........Diabetic Nephropathy1
      7. ........Endothelium2
      8. ........Heart Failure2
      9. ........Hypertension8
      10. ........Myocardial Contractility1
      11. ........Myocardial Hypertrophy1
      12. ........Myocardial Infarction4
      13. ........Serum Proteins1
      14. ........Smooth Muscle Cells3
      15. ........Stroke2
      16. ........Thrombosis3
      17. ........Vasoconstriction9
      18. ........Vasodilation5
    25. ....Ox Stress Reagents6
      1. ........Antioxidants2
      2. ........Carbohydrate Oxidation1
      3. ........Lipid Peroxidation1
      4. ........Pro-Oxidant Activity1
    26. ....Others27
      1. ........Adenylate cyclase1
      2. ........Cell Penetrating Peptide2
      3. ........Cytokine1
      4. ........Enzyme Substrates / Activators7
      5. ........Fluorescent Probes7
      6. ........Glycoprotein1
      7. ........Guanylate Cyclase 1
      8. ........MDR multidrug resistance1
      9. ........Myosin2
      10. ........Natriuretic Peptide Receptors4
      11. ........Nitric Oxide2
      12. ........Renin1
      13. ........Tachykinin3
      14. ........Transcription Factors4
      15. ........Others8
      16. ........Cyclase1
      17. ........Negative Controls1
      18. ........Toxicology1
    27. ....Antiparasitics1
  2. Amino Acids & Building Blocks5
    1. ....Peptide Coupling Reagents5
    2. ....Amino Acids and Derivatives1
  3. Natural Products6
  4. Labeling & Detection13
    1. ....Cyanine Dyes1
    2. ....Others1
    3. ....Dyes, Stains & Indicators1
    4. ....Enzyme Substrates2
    5. ....Fluorescence9
  5. Biochemical Assay Reagents2
  6. Peptides428
    1. ....Tag Peptides10
    2. ....Amyloid β protein67
    3. ....Neuropeptides25
    4. ....Peptide Hormones22
  7. Infectious Disease30
    1. ....Viral Diseases2
      1. ........Dengue1
      2. ........HIV1
      3. ........Yellow Fever1
    2. ....Bacterial Diseases24
      1. ........Food-Borne Illnesses1
      2. ........MRSA3
      3. ........Pneumonia3
      4. ........Tuberculosis3
    3. ....Fungal Diseases9
      1. ........Candidiasis5
      2. ........Pneumonia2
    4. ....Parasitic Diseases1
    5. ....Quorum Sensing2
  8. Proteins4
    1. ....Growth Factors1
      1. ........Macrophage Migration Inhibitory Factor1
    2. ....Hormones2
      1. ........Peptide Hormones2
    3. ....Recombinant Proteins1
      1. ........Superoxide Dismutase1