Dulaglutide (LY2189265) (Synonyms: HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG) |
رقم الكتالوجGC31520 |
دولاغلوتايد (LY-2189265) هو مشتق جديد لهرمون الببتيد المشابه للجلوكاجون 1 (GLP-1) ذات فعالية طويلة، وذلك لعلاج مرض السكري من النمط 2.
Products are for research use only. Not for human use. We do not sell to patients.
Cas No.: 923950-08-7
Sample solution is provided at 25 µL, 10mM.
Quality Control & SDS
- View current batch:
- Purity: >98.00%
- COA (Certificate Of Analysis)
- SDS (Safety Data Sheet)
- Datasheet
Cell experiment [1]: | |
Cell lines |
HepG2 cells |
Preparation Method |
HepG2 cells were pretreated with 400 μM PA for 24 hours, followed by treatment with or without 100 nM Dulaglutide (LY2189265) for 24 hours. |
Reaction Conditions |
100 nM Dulaglutide (LY2189265) for 24 hours. |
Applications |
Dulaglutide (LY2189265) significantly decreased hepatic lipid accumulation and reduced the expression of genes associated with lipid droplet binding proteins, de novo lipogenesis, and TG synthesis in PA-treated HepG2 cells. Dulaglutide (LY2189265) also increased the expression of proteins associated with lipolysis and fatty acid oxidation and FAM3A in PA-treated cells. |
Animal experiment [2]: | |
Animal models |
Young (4 months) and old (24 months) C57BL/6J male mice |
Preparation Method |
The mice were subcutaneously administered 600 μg/kg/week Dulaglutide (LY2189265) for 4 weeks. Body weight and food intake were assessed daily. The mice were weighed and humanely sacrificed after 4 weeks of treatment. |
Dosage form |
600 μg/kg/week Dulaglutide (LY2189265) for 4 weeks |
Applications |
Dulaglutide (LY2189265) administration attenuated muscle wasting and restored muscle strength by reducing inflammation through the OPA-1-TLR-9 signaling pathway in the tibialis anterior (TA) and quadriceps (QD) muscles of aged mice. |
References: [1]. Lee J, Hong SW, et,al. Dulaglutide Ameliorates Palmitic Acid-Induced Hepatic Steatosis by Activating FAM3A Signaling Pathway. Endocrinol Metab (Seoul). 2022 Feb;37(1):74-83. doi: 10.3803/EnM.2021.1293. Epub 2022 Feb 9. PMID: 35144334; PMCID: PMC8901965. [2]. Khin PP, Hong Y, et,al. Dulaglutide improves muscle function by attenuating inflammation through OPA-1-TLR-9 signaling in aged mice. Aging (Albany NY). 2021 Sep 19;13(18):21962-21974. doi: 10.18632/aging.203546. Epub 2021 Sep 19. PMID: 34537761; PMCID: PMC8507261. |
دولاغلوتايد (LY-2189265) هو مشتق جديد لهرمون الببتيد المشابه للجلوكاجون 1 (GLP-1) ذات فعالية طويلة، وذلك لعلاج مرض السكري من النمط 2.
أدى دولاغلوتيد (LY2189265) إلى تقليل تراكم الدهون في الكبد وخفض تعبير الجينات المرتبطة ببروتينات ربط قطرات الدهون، والليبوجينيس التحديثية، وتخلص TG في خلايا HepG2 المعالجة بـ PA. كما زاد دولاغلوتيد (LY2189265) من تعبير البروتينات المرتبطة بالشحمية وأكسدة حمض الدهني و FAM3A في خلايا معالجة PA[8]. أظهر استخدام دولاغلوتاز (LY2189265) زيادة كفاءة ما يسمى "microglia" لابتلاع صفائح Aβ. علاوة على ذلك، أثَّرَ استخدام دولاغلُّودِّ( LY2189265 ) على منع إِصْدارُ عُامِّلَ التهابٍ مثْل TNF-α, interleukin -1β, and IL-6، فضلاً عن زِیادَۃ نسْبَۃ جزیئات مضادَّۃ لِإِصابَۃ التهابیَّۃ مثل IL-10 المتأثرة بالتعرض لـ Aβ1-42[9].
أدت إعطاء دولاغلوتيد (LY2189265) إلى تقليل هدم العضلات واستعادة قوة العضلات عن طريق تخفيف الالتهاب من خلال مسار التوصيل بين OPA-1-TLR-9 في عضلات tibialis anterior (TA) وquadriceps (QD) لفئران المسنَّة[3]. يمكن أن يُخفِّض دولاغلوتيد (LY2189265) فرط هرمون الذكورة في فئران متلازمة تكيس المبايض PCOS من خلال ضبط محتوى SHBG في المصل وتعبير جينات 3βHSD، CYP19α1، StAR ذات الصِِّــــــغَية، وبروتينها، مثمِّلا بذلك التحكم في التطور المفرط لجُرْثُـــُ�َى صغيرة وظهور جُرْثُکیستية في المبايض لديها، حاملا بذلك على تحسین حالة تكیس المبایض PCOS لديها[4]. يحسِّن دولاغلوتيد (LY2189265) القدرة على التعلم والذاكرة لفئران C57/BL6 ذات النوعية البرية من الذكور في سن 9 أسابيع (AD mice)[2].
بعد الحقن تحت الجلد، تم امتصاص Dulaglutide (LY2189265) ببطء وكان tmax في الحالة المستقرة يتراوح بين 24 إلى 72 ساعة (الوسيط = 48 ساعة). كانت نسبة الامتصاص الحيوي المطلق هي 47٪ وقُدِّر نصف العمر على أنه 4.7 يومًا. تم التوصل إلى حالة مستقرة بين 2 و4 أسابيع من جرعات التخدير ، وكان معدل التراكم حوالي 1.56.
References:
[1]:Jimenez-Solem E, Rasmussen MH, et,al. Dulaglutide, a long-acting GLP-1 analog fused with an Fc antibody fragment for the potential treatment of type 2 diabetes. Curr Opin Mol Ther. 2010 Dec;12(6):790-7. PMID: 21154170.
[2]: Jiang Guo-Jing, ZHOU Mei, et,al. Protective effects of dura glycopeptide on learning and memory loss and synaptic degeneration in AD mice [J]. Medical theory & practice,2021,34(14):2365-2368.
[3]: Khin PP, Hong Y, et,al. Dulaglutide improves muscle function by attenuating inflammation through OPA-1-TLR-9 signaling in aged mice. Aging (Albany NY). 2021 Sep 19;13(18):21962-21974. doi: 10.18632/aging.203546. Epub 2021 Sep 19. PMID: 34537761; PMCID: PMC8507261.
[4]: Wu LM, Wang YX, et,al. Dulaglutide, a long-acting GLP-1 receptor agonist, can improve hyperandrogenemia and ovarian function in DHEA-induced PCOS rats. Peptides. 2021 Nov;145:170624. doi: 10.1016/j.peptides.2021.170624. Epub 2021 Aug 8. PMID: 34375684.
[5]: Barrington P, Chien JY, et,al. A 5-week study of the pharmacokinetics and pharmacodynamics of LY2189265, a novel, long-acting glucagon-like peptide-1 analogue, in patients with type 2 diabetes. Diabetes Obes Metab. 2011 May;13(5):426-33. doi: 10.1111/j.1463-1326.2011.01364.x. Epub 2011 Jan 19. PMID: 21251178.
[6]: Barrington P, Chien JY, et,al. LY2189265, a long-acting glucagon-like peptide-1 analogue, showed a dose-dependent effect on insulin secretion in healthy subjects. Diabetes Obes Metab. 2011 May;13(5):434-8. doi: 10.1111/j.1463-1326.2011.01365.x. Epub 2011 Jan 19. PMID: 21251179.
[7]: Scheen AJ. Dulaglutide (LY-2189265) for the treatment of type 2 diabetes. Expert Rev Clin Pharmacol. 2016;9(3):385-99. doi: 10.1586/17512433.2016.1141046. Epub 2016 Feb 6. PMID: 26761217.
[8]: Lee J, Hong SW, et,al. Dulaglutide Ameliorates Palmitic Acid-Induced Hepatic Steatosis by Activating FAM3A Signaling Pathway. Endocrinol Metab (Seoul). 2022 Feb;37(1):74-83. doi: 10.3803/EnM.2021.1293. Epub 2022 Feb 9. PMID: 35144334; PMCID: PMC8901965.
[9]: Wang Y, Han B. Dulaglutide Alleviates Alzheimer's Disease by Regulating Microglial Polarization and Neurogenic Activity. Comb Chem High Throughput Screen. 2022 Jul 26. doi: 10.2174/1386207325666220726163514. Epub ahead of print. PMID: 35894460.
Cas No. | 923950-08-7 | SDF | |
المرادفات | HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG | ||
Formula | C149H221N37O49 | M.Wt | 3314.62 |
الذوبان | > 40mg/mL in water | Storage | Store at -20°C |
General tips | Please select the appropriate solvent to prepare the stock solution according to the
solubility of the product in different solvents; once the solution is prepared, please store it in
separate packages to avoid product failure caused by repeated freezing and thawing.Storage method
and period of the stock solution: When stored at -80°C, please use it within 6 months; when stored
at -20°C, please use it within 1 month. To increase solubility, heat the tube to 37°C and then oscillate in an ultrasonic bath for some time. |
||
Shipping Condition | Evaluation sample solution: shipped with blue ice. All other sizes available: with RT, or with Blue Ice upon request. |
Prepare stock solution | |||
1 mg | 5 mg | 10 mg | |
1 mM | 0.3017 mL | 1.5085 mL | 3.0169 mL |
5 mM | 0.0603 mL | 0.3017 mL | 0.6034 mL |
10 mM | 0.0302 mL | 0.1508 mL | 0.3017 mL |
Step 1: Enter information below (Recommended: An additional animal making an allowance for loss during the experiment)
Step 2: Enter the in vivo formulation (This is only the calculator, not formulation. Please contact us first if there is no in vivo formulation at the solubility Section.)
Calculation results:
Working concentration: mg/ml;
Method for preparing DMSO master liquid: mg drug pre-dissolved in μL DMSO ( Master liquid concentration mg/mL, Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug. )
Method for preparing in vivo formulation: Take μL DMSO master liquid, next addμL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O, mix and clarify.
Method for preparing in vivo formulation: Take μL DMSO master liquid, next add μL Corn oil, mix and clarify.
Note: 1. Please make sure the liquid is clear before adding the next solvent.
2. Be sure to add the solvent(s) in order. You must ensure that the solution obtained, in the previous addition, is a clear solution before proceeding to add the next solvent. Physical methods such as vortex, ultrasound or hot water bath can be used to aid dissolving.
3. All of the above co-solvents are available for purchase on the GlpBio website.
Average Rating: 5
(Based on Reviews and 22 reference(s) in Google Scholar.)GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *