الصفحة الرئيسية >> Signaling Pathways >> Neuroscience >> Neuroscience Peptides

Neuroscience Peptides

Neuroscience

Neurons communicate with each other, effector organs and sensory organs through the neurotransmitter – receptor pathway at synapses. Neurotransmitters can be divided into 4 major groups: 1. Amino acids (glumate, aspartate, serine, glycine and GABA); 2. Monoamines (norepinephrine, epinephrine, dopamine, histamine, and serotonin); 3. Peptides (opioid peptides, substance P, somatostatin); and 4. Others (acetylcholine, NO, nucleosides). read more

منتجات لـ نبسب؛ Neuroscience Peptides

  1. القط. رقم اسم المنتج بيانات
  2. GP10121 Ac-Endothelin-1 (16-21), human Ac-Endothelin-1 (16-21), human  Chemical Structure
  3. GP10109 Adrenorphin Adrenorphin  Chemical Structure
  4. GP10102 Adrenorphin, Free Acid Adrenorphin, Free Acid  Chemical Structure
  5. GP10076 Agouti-related Protein (AGRP) (25-82), human Agouti-related Protein (AGRP) (25-82), human  Chemical Structure
  6. GP10099 amyloid A protein fragment [Homo sapiens] Apolipoproteins related to HDL in plasma amyloid A protein fragment [Homo sapiens]  Chemical Structure
  7. GP10118 Amyloid Beta-Peptide (1-40) (human)

    ببتيد أميلويد بيتا (1-40) (الإنسان)، (C194H295N53O58S1)، وهو ببتيد يحتوي على التسلسل H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH، الكتلة الجزيئية = 4329.8. يعد أميلويد بيتا (Aβ أو Abeta) من الببتيدات المكونة لـ 36-43 حمضًا أمينية والذي يُصَنَّع من بروتين مُستَخِرِج الأميلود.

    Amyloid Beta-Peptide (1-40) (human)  Chemical Structure
  8. GP10049 Amyloid Beta-Peptide (12-28) (human)

    Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)).

    Amyloid Beta-Peptide (12-28) (human)  Chemical Structure
  9. GP10082 Amyloid Beta-peptide (25-35) (human)

    الببتيد بيتا الأميلويد (25-35) (الإنسان) هو جزء من ببتيد أميلويد بيتا في مرض الزهايمر وله تأثيرات عصبية سامة.

    Amyloid Beta-peptide (25-35) (human)  Chemical Structure
  10. GP10046 Amyloid Precursor C-Terminal Peptide

    For beta amyloid generation

    Amyloid Precursor C-Terminal Peptide  Chemical Structure
  11. GP10057 Amyloid β-Peptide (10-20) (human) Amyloid β-Peptide (10-20) (human)  Chemical Structure
  12. GP10094 Amyloid β-peptide (10-35), amide Amyloid β-peptide (10-35), amide  Chemical Structure
  13. GP10097 Amyloid β-Protein (1-15) Amyloid β-Protein (1-15)  Chemical Structure
  14. GP10083 Beta-Amyloid (1-11) Beta-Amyloid (1-11)  Chemical Structure
  15. GP10051 Beta-Lipotropin (1-10), porcine

    Morphine-like substance

    Beta-Lipotropin (1-10), porcine  Chemical Structure
  16. GP10101 Beta-Sheet Breaker Peptide iAβ5 Beta-Sheet Breaker Peptide iAβ5  Chemical Structure
  17. GP10127 Cadherin Peptide, avian

    Role in cell adhesion

    Cadherin Peptide, avian  Chemical Structure
  18. GP10010 COG 133 COG 133  Chemical Structure
  19. GP10126 Diazepam-Binding Inhibitor Fragment, human Diazepam-Binding Inhibitor (DBI) Fragment is encoded by the DBI gene in human. Diazepam-Binding Inhibitor Fragment, human  Chemical Structure
  20. GP10070 Dynorphin (2-17), amide, porcine Dynorphin (2-17), amide, porcine  Chemical Structure
  21. GP10065 Endomorphin-1 Endomorphin-1  Chemical Structure
  22. GP10146 ferritin heavy chain fragment [Multiple species] ferritin heavy chain fragment [Multiple species]  Chemical Structure
  23. GP10107 Gap 26 Gap 26  Chemical Structure
  24. GP10119 Gap 27

    A connexin-mimetic peptide

    Gap 27  Chemical Structure
  25. GP10115 GTP-Binding Protein Fragment, G alpha GTP-Binding Protein Fragment, G alpha  Chemical Structure
  26. GP10041 Insulin like growth factor II fragment variant Insulin like growth factor II fragment variant has a sequence of Thr-Pro-Thr-Lys-Ser-Glu-Arg. Insulin like growth factor II fragment variant  Chemical Structure
  27. GC14612 JNJ-31020028 JNJ-31020028 هو مضاد انتقائي واختراق الدماغ لمستقبلات الببتيد العصبي Y Y2 مع قيم pIC50 تبلغ 8.07 و 8.22 لمستقبلات Y2 البشرية والفئران ، على التوالي JNJ-31020028  Chemical Structure
  28. GP10103 Laminin (925-933)

    لامينين (925-933) (CDPGYIGSR) هو تسلسل لامينين على سلسلة B1.

    Laminin (925-933)  Chemical Structure
  29. GP10066 Melanocyte stimulating hormone release inhibiting factor Melanocyte stimulating hormone release inhibiting factor  Chemical Structure
  30. GP10006 Myelin Basic Protein (68-82), guinea pig Myelin Basic Protein (68-82), guinea pig  Chemical Structure
  31. GP10130 Myelin Basic Protein (87-99)

    An encephalitogenic peptide

    Myelin Basic Protein (87-99)  Chemical Structure
  32. GP10011 Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell  Chemical Structure
  33. GP10069 Parathyroid hormone (1-34) (human) Parathyroid hormone (1-34) (human)  Chemical Structure
  34. GP10106 Parathyroid Hormone (1-34), bovine Parathyroid Hormone (1-34), bovine  Chemical Structure
  35. GP10014 parathyroid hormone (7-34) [Homo sapiens]/[Macaca fascicularis]

    Enhancer of blood calcium level

    parathyroid hormone (7-34) [Homo sapiens]/[Macaca fascicularis]  Chemical Structure
  36. GP10032 Rac GTPase fragment

    Fragment of small signaling G proteins

    Rac GTPase fragment  Chemical Structure
  37. GP10042 Rhodopsin peptide Rhodopsin peptide  Chemical Structure
  38. GP10084 type II collagen fragment type II collagen fragment  Chemical Structure
  39. GP10017 [Ser25] Protein Kinase C (19-31)

    PKC substrate

    [Ser25] Protein Kinase C (19-31)  Chemical Structure
  40. GP10081 α-Endorphin α-Endorphin  Chemical Structure
  41. GP10111 β-Pompilidotoxin β-Pompilidotoxin  Chemical Structure

40 عنصر (عناصر)

لكل صفحة

تحديد الاتجاه التنازلي