LL-37 (trifluoroacetate salt) (Synonyms: CAP-18, hCAP-18, Cathelicidin, FALL-39) |
| Catalog No.GC14377 |
LL-37 contains 37 amino acid residues with the first two leucine residues (L1LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES37) and mostly exists in epithelial cells and neutrophils.
Products are for research use only. Not for human use. We do not sell to patients.
Cas No.: 154947-66-7
Sample solution is provided at 25 µL, 10mM.
_1-3.$$$39978408@51.jpg');)
_1-9.$$$38538795@65.jpg');)
_1-9.$$$39112701@51.jpg');)
_1-7.$$$37316672@70.jpg');)
_366-372.$$$36198801@70.jpg');)
.$$$38565142@65.jpg');)
_1867-1883.$$$33248023@67.jpg');)
_eads6055.$$$39977546@45.jpg');)
_eadm9805.$$$40080571@45.jpg');)
_eadj3020.$$$39666821@45.jpg');)
_1-20.$$$39757301@28.jpg');)
_1-24.$$$38898113@28.jpg');)
_273-287.$$$36806353@46.jpg');)
_1-16.$$$37156877@44.jpg');)
_1-19.$$$37460805@44.jpg');)
_1291-1307.$$$34518654@46.jpg');)
LL-37 contains 37 amino acid residues with the first two leucine residues (L1LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES37) and mostly exists in epithelial cells and neutrophils.
In vitro experiment it shown that treatment with 4 and 10 μM LL-37 reduced both the number and viability of human osteoblast-like MG63 cell.[2] In vitro, the pretreatment of pMSCs with 1 and 10 μg/mL of LL-37 had not effect on the migratory cells ability. But the pretreatment with 1 μg/mL of LL-37 increased the migratory potential of pMSCs after 48 h.[4] In vitro study it indicated that at 1 µmol/L concentrations of LL-37 for 24 hours, LL-37 prevented LPS-induced stimulation of MCP-1 expression analyzed both on transcript and on protein levels, but had no effect on toll-like receptor (TLR)2 and TLR4 transcript expression. In the meanwhile, treatment with 0.1 and 1 µmol/L LL-37 for 60 minutes in PDL cell induced immunoreactivity for LL-37.[5]
In vivo study it suggested that treatment with 2 μg/mouse of LL-37 intravenously improves the survival of CLP septic mice in a dose-dependent effect. LL-37 ameliorates the level of ectosomes with higher antibacterial potential, result in reducing the bacterial load in CLP mice.[1] LL-37 dose-dependently (1, 3, or 10 μg/ml) induced ectosome release from neutrophil. Injection LL-37 supressed the infiltration of polymorphonuclear cells in CLP mice, where the bacterial burden and inflammatory response are decreased.[3]
References:
[1].Nagaoka I, et al. Therapeutic Potential of Cathelicidin Peptide LL-37, an Antimicrobial Agent, in a Murine Sepsis Model. Int J Mol Sci. 2020 Aug 19;21(17):5973.
[2].Bankell E, et al. LL-37-induced caspase-independent apoptosis is associated with plasma membrane permeabilization in human osteoblast-like cells. Peptides. 2021 Jan;135:170432.
[3].Kumagai Y, et al. Antimicrobial peptide LL-37 ameliorates a murine sepsis model via the induction of microvesicle release from neutrophils. Innate Immun. 2020 Oct;26(7):565-579.
[4].Oliveira-Bravo M, et al. LL-37 boosts immunosuppressive function of placenta-derived mesenchymal stromal cells. Stem Cell Res Ther. 2016 Dec 30;7(1):189.
[5].Aidoukovitch A, et al. The host defense peptide LL-37 is internalized by human periodontal ligament cells and prevents LPS-induced MCP-1 production. J Periodontal Res. 2019 Dec;54(6):662-670.
| Cell experiment [1]: | |
|
Cell lines |
HaCaT cells |
|
Preparation Method |
HaCaT cells were transfected with a 2 μg of empty vector and 0.1, 0.5, 1, or 2 μg of LL-37 plasmids for 6 h and then internalized with P. gingivalis (MOI 100, 6 h) using the antibiotic protection assay. Total RNA was extracted after 18 h. |
|
Reaction Conditions |
0.1, 0.5, 1, or 2 μg; 6 h |
|
Applications |
The qRT-PCR results showed that compared with the control cells, the number of live P. gingivalis was significantly reduced by 0.79, 0.62, and 0.69 times in cells transfected with 0.5, 1, or 2 μg of LL 37 plasmids, respectively. LL 37 mRNA expression gradually increased significantly as transfected with 0.1, 0.5, or 1 μg of LL 37 plasmids, which was followed by a decrease and reached a peak in cells treated with 1 μg of LL 37 plasmids. |
| Animal experiment [2]: | |
|
Animal models |
BALB/c female mice |
|
Preparation Method |
Mice were intravenously injected with PBS (200 μl) or LL 37 (3 μg/200 μl in PBS) just prior to CLP or sham operation. Peritoneal exudates (3 ml) and blood were collected 14–16 h after the operation, and the number of bacteria and inflammatory cells was determined. |
|
Dosage form |
3 μg/200 μl in PBS; i.v. |
|
Applications |
LL 37 administration significantly reduced the bacterial load in the peritoneal exudates (PBS-CLP vs LL-37-CLP) as well as blood. |
|
References: |
|
| Cas No. | 154947-66-7 | SDF | |
| Synonyms | CAP-18, hCAP-18, Cathelicidin, FALL-39 | ||
| Canonical SMILES | CC[C@]([C@@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/C/N=C(O)/[C@](/N=C(O)/[C@](N)([H])CC(C)C)([H])CC(C)C)([H])CC(O)=O)([H])CC1=CC=CC=C1)([H])CC2=CC=CC=C2)([H])CCCNC(N)=N | ||
| Formula | C205H340N60O53 • XCF3COOH | M.Wt | 4493.3 |
| Solubility | Water: 1 mg/ml | Storage | Store at -20°C |
| General tips | Please select the appropriate solvent to prepare the stock solution according to the
solubility of the product in different solvents; once the solution is prepared, please store it in
separate packages to avoid product failure caused by repeated freezing and thawing.Storage method
and period of the stock solution: When stored at -80°C, please use it within 6 months; when stored
at -20°C, please use it within 1 month. To increase solubility, heat the tube to 37°C and then oscillate in an ultrasonic bath for some time. |
||
| Shipping Condition | Evaluation sample solution: shipped with blue ice. All other sizes available: with RT, or with Blue Ice upon request. | ||
| Prepare stock solution | |||
|
1 mg | 5 mg | 10 mg |
| 1 mM | 0.2226 mL | 1.1128 mL | 2.2255 mL |
| 5 mM | 0.0445 mL | 0.2226 mL | 0.4451 mL |
| 10 mM | 0.0223 mL | 0.1113 mL | 0.2226 mL |
Step 1: Enter information below (Recommended: An additional animal making an allowance for loss during the experiment)
g
μL
Step 2: Enter the in vivo formulation (This is only the calculator, not formulation. Please contact us first if there is no in vivo formulation at the solubility Section.)
Calculation results:
Working concentration: mg/ml;
Method for preparing DMSO master liquid: mg drug pre-dissolved in μL DMSO ( Master liquid concentration mg/mL, Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug. )
Method for preparing in vivo formulation: Take μL DMSO master liquid, next addμL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O, mix and clarify.
Method for preparing in vivo formulation: Take μL DMSO master liquid, next add μL Corn oil, mix and clarify.
Note: 1. Please make sure the liquid is clear before adding the next solvent.
2. Be sure to add the solvent(s) in order. You must ensure that the solution obtained, in the previous addition, is a clear solution before proceeding to add the next solvent. Physical methods such as vortex, ultrasound or hot water bath can be used to aid dissolving.
3. All of the above co-solvents are available for purchase on the GlpBio website.
Quality Control & SDS
- View current batch:
- Purity: >98.00%
- COA (Certificate Of Analysis)
- SDS (Safety Data Sheet)
- Datasheet
Average Rating: 5 (Based on Reviews and 1 reference(s) in Google Scholar.)
GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *