CJ 033466 |
Catalog No.GC13583 |
5-HT4 partial agonist
Products are for research use only. Not for human use. We do not sell to patients.
Cas No.: 519148-48-2
Sample solution is provided at 25 µL, 10mM.
GlpBio Products Cited In Reputable Papers
Product Documents
Quality Control & SDS
- View current batch:
- Purity: >98.00%
- COA (Certificate Of Analysis)
- SDS (Safety Data Sheet)
- Datasheet
Cas No. | 519148-48-2 | SDF | |
Chemical Name | 5-amino-6-chloro-N-((1-isobutylpiperidin-4-yl)methyl)-2-methylimidazo[1,2-a]pyridine-8-carboxamide | ||
Canonical SMILES | ClC1=C(N)N2C(C(C(NCC3CCN(CC(C)C)CC3)=O)=C1)=NC(C)=C2 | ||
Formula | C19H28ClN5O | M.Wt | 377.91 |
Solubility | <37.79mg/ml in DMSO; <37.79mg/ml in ethanol | Storage | Store at -20°C |
General tips | Please select the appropriate solvent to prepare the stock solution according to the
solubility of the product in different solvents; once the solution is prepared, please store it in
separate packages to avoid product failure caused by repeated freezing and thawing.Storage method
and period of the stock solution: When stored at -80°C, please use it within 6 months; when stored
at -20°C, please use it within 1 month. To increase solubility, heat the tube to 37°C and then oscillate in an ultrasonic bath for some time. |
||
Shipping Condition | Evaluation sample solution: shipped with blue ice. All other sizes available: with RT, or with Blue Ice upon request. |
Complete Stock Solution Preparation Table
Prepare stock solution | |||
1 mg | 5 mg | 10 mg | |
1 mM | 2.6461 mL | 13.2307 mL | 26.4613 mL |
5 mM | 0.5292 mL | 2.6461 mL | 5.2923 mL |
10 mM | 0.2646 mL | 1.3231 mL | 2.6461 mL |
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal making an allowance for loss during the experiment)
Step 2: Enter the in vivo formulation (This is only the calculator, not formulation. Please contact us first if there is no in vivo formulation at the solubility Section.)
Calculation results:
Working concentration: mg/ml;
Method for preparing DMSO master liquid: mg drug pre-dissolved in μL DMSO ( Master liquid concentration mg/mL, Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug. )
Method for preparing in vivo formulation: Take μL DMSO master liquid, next addμL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O, mix and clarify.
Method for preparing in vivo formulation: Take μL DMSO master liquid, next add μL Corn oil, mix and clarify.
Note: 1. Please make sure the liquid is clear before adding the next solvent.
2. Be sure to add the solvent(s) in order. You must ensure that the solution obtained, in the previous addition, is a clear solution before proceeding to add the next solvent. Physical methods such as vortex, ultrasound or hot water bath can be used to aid dissolving.
3. All of the above co-solvents are available for purchase on the GlpBio website.
Related Products
- GC34245 GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
- GC40367 (±)9-HEPE
- GC30577 Endothelin Mordulator 1
- GC30393 Litronesib Racemate (LY-2523355 Racemate)
- GC12508 Nutlin-3b
- GC12588 I-BRD9
- GC38601 N3-Ph-NHS ester
- GC43407 Demethylwedelolactone
- GC10411 MRS 2219
- GC36678 N4-Acetylcytidine triphosphate sodium
- GC60890 Guvacine
- GC36087 FUBP1-IN-1
- GN10702 Asiatic acid
- GC30759 H3 receptor-MO-1
- GC37631 Seviteronel
- GC30870 Nialamide
- GC19216 KYA1797K
Reviews
Average Rating: 5 ★★★★★ (Based on Reviews and 28 reference(s) in Google Scholar.)
GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *