- Bestell-Nr. Artikelname Informationen
-
GC44598
Peptide YY (human) (trifluoroacetate salt)
Peptide YY (PYY) is a 36-amino acid peptide and anorectic gut hormone agonist for the neuropeptide Y receptors Y1, Y2, Y5, and Y6 with EC50 values of 0.7, 0.58, 1, and 0.8 nM, respectively, for supression of forskolin-induced cAMP accumulation.
- GC63855 Peptide YY (PYY) (3-36), porcine TFA Peptid YY (PYY) (3-36), Schweine-TFA ist ein Darmhormonpeptid, das als Y2-Rezeptoragonist wirkt, um den Appetit zu reduzieren.
- GC32335 Peptide T TFA Peptid T (TFA) ist ein Octapeptid aus der V2-Region von HIV-1 gp120.
- GC32309 Peptide T Peptid T ist ein Octapeptid aus der V2-Region von HIV-1 gp120.
- GC31767 Peptide 401 Peptid 401, ein starker Mastzell-Degranulationsfaktor aus Bienengift, unterdrÜckt die erhÖhte GefÄßpermeabilitÄt aufgrund der intradermalen Injektion verschiedener Spasmogene der glatten Muskulatur (Histamin und 5-HT).
- GP10131 Peptide YY(3-36), PYY, human
- GC52502 Peptide YY (3-36) (trifluoroacetate salt) A satiety hormone
- GC63347 Peptide 78 Peptid 78, ein chemotaktisches Zytokin, ein 78 AminosÄuren langes Proteinmitglied der IL-8- oder C-X-C-Chemokin-Supergenfamilie.
- GC30452 Peptide YY (PYY), human Peptid YY (PYY) ist ein Darmhormon, das den Appetit reguliert und die Sekretion der BauchspeicheldrÜse hemmt.
- GC50439 Peptide5 Peptid5, ein Connexin 43-mimetisches Peptid, reduziert Schwellungen, Astrogliose und neuronalen Zelltod nach einer RÜckenmarksverletzung bei TierenIn Vitro: Peptid5 reduziert signifikant den Grad der RÜckenmarksverletzung (SCI) in einem Nagetier-Ex-vivo-Modell.
-
GC30535
Transdermal Peptide (TD 1 (peptide))
Transdermal Peptide (TD 1 (peptide)), consisting of 11 amino acids, is the first transdermal enhancing peptide discovered by phage display.
- GC34397 Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) Synthetisches Sphistin-Peptid (12-38, Fitc in N-terminal fluoreszierend markiertem Peptid) ist ein verkÜrztes Fragment des synthetischen Sphistin-Peptids, das eine starke antimikrobielle AktivitÄt zeigt.
-
GP10118
Amyloid Beta-Peptide (1-40) (human)
Amyloid β-Peptid (1-40) (human), (C194H295N53O58S1), ist ein Peptid mit der Sequenz H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid-Beta (Aβ oder Abeta) ist ein Peptid von 36–43 Aminosäuren, das aus dem Amyloid-Vorläuferprotein verarbeitet wird.
- GC52376 BMP2-derived Peptide (trifluoroacetate salt) A synthetic peptide
- GC44655 PKCε Inhibitor Peptide PKCε Inhibitorpeptid (ε-V1-2), ein von PKC&7#949; abgeleitetes Peptid, ist ein selektives PKCε Inhibitor.
- GP10091 Vasonatrin Peptide (1-27) Vasonatrin Peptide (1-27), (C124H198N36O36S3), a peptide with the sequence H2N-GLSKGCFGLKLDRIGSMSGLGCNSFRY-OH, MW= 2865.4.
-
GP10082
Amyloid Beta-peptide (25-35) (human)
Amyloid-Beta-Peptid (25-35) (human) ist ein Fragment des Alzheimer Amyloid-Beta-Peptids, das neurotoxische Effekte hat.
- GC52385 Myelin Basic Protein (85-99) Peptide Antagonist (trifluoroacetate salt) An MBP (85-99) antagonist
- GC52361 AMARA Peptide (trifluoroacetate salt) A peptide substrate for AMPK
- GC52196 RGD Peptide RGD-Peptid wirkt als Inhibitor von Integrin-Liganden-Wechselwirkungen und spielt eine wichtige Rolle bei ZelladhÄsion, Migration, Wachstum und Differenzierung.
- GC49883 DAPK Substrate Peptide (trifluoroacetate salt) A DAPK1 peptide substrate
- GC37524 RGD peptide (GRGDNP) TFA
- GC44806 Ras Inhibitory Peptide Son of sevenless homolog 1 (Sos1) is a guanine nucleotide exchange factor (GEF) that directs the exchange of Ras-GDP to Ras-GTP by binding to SH3 domains of the growth factor receptor-bound protein 2 (Grb2), leading to the activation of ERK.
- GP10104 S6 Kinase Substrate Peptide 32 Measures the activity of kinases that phosphorylate ribosomal protein S6.
- GP10108 EGF-R (661-681) T669 Peptide
- GP10011 Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell
- GP10098 Cdk2/Cyclin Inhibitory Peptide I
- GP10094 Amyloid β-peptide (10-35), amide
- GP10042 Rhodopsin peptide
-
GP10127
Cadherin Peptide, avian
Role in cell adhesion
- GP10095 Epidermal Growth Factor Receptor Peptide (985-996)
-
GP10043
GnRH Associated Peptide (GAP) (1-13), human
Inhibitor of prolactin secretion
-
GP10089
Platelet Membrane Glycoprotein IIB Peptide (296-306)
Inhibits platelet aggregation
-
GP10046
Amyloid Precursor C-Terminal Peptide
For beta amyloid generation
- GP10049 Amyloid Beta-Peptide (12-28) (human)
- GP10022 Dynamin inhibitory peptide
- GP10057 Amyloid β-Peptide (10-20) (human)
- GC38520 PTD-p65-P1 Peptide TFA PTD-p65-P1-Peptid TFA ist ein potenter, selektiver Inhibitor des nuklearen Transkriptionsfaktors NF-κB und leitet sich von der p65-Untereinheit der NF-κB-AminosÄurereste 271-282 ab, die selektiv die NF-κB-Aktivierung, die durch verschiedene EntzÜndungsstimulationen induziert wird, herunter hemmt -regulieren die NF-κB-vermittelte Genexpression und regulieren die Apoptose hoch.
- GC60095 Brain Natriuretic Peptide (1-32), rat acetate Brain Natriuretic Peptide (1-32), Rattenacetat (BNP (1-32), Rattenacetat) ist ein Polypeptid aus 32 AminosÄuren, das von den Ventrikeln des Herzens als Reaktion auf ÜbermÄßige Dehnung der Herzmuskelzellen (Kardiomyozyten) ausgeschieden wird .
- GC36150 Glucagon-Like Peptide (GLP) I (7-36), amide, human Glucagon-Like Peptide (GLP) I (7-36), Amid, human, ist ein physiologisches Inkretinhormon, das die Insulinsekretion stimuliert.
- GC34023 Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Atriales natriuretisches Peptid (ANP) (1-28), Mensch, Schwein (Atriales natriuretisches Peptid (ANP) (1-28), Mensch, Schwein) ist ein 28-AminosÄuren-Hormon, das normalerweise vom menschlichen Herzen produziert und ausgeschieden wird als Reaktion auf Herzverletzung und mechanische Dehnung.
- GC33690 Crustacean Cardioactive Peptide CCAP Crustacean Cardioactive Peptide CCAP ist ein hoch konserviertes, amidiertes zyklisches Nonapeptid, das zuerst aus den Perikardorganen der Strandkrabbe Carcinus maenas isoliert wurde, wo es eine Rolle bei der Regulierung des Herzschlags spielt; Crustacean Cardioactive Peptide CCAP moduliert auch die neuronale Aktivität in anderen Arthropoden.
- GC32589 Brain Natriuretic Peptide (BNP) (1-32), rat Brain Natriuretic Peptide (BNP) (1-32), Ratte (BNP (1-32), Ratte) ist ein 32 AminosÄuren langes Polypeptid, das von den Herzkammern als Reaktion auf eine ÜbermÄßige Dehnung der Herzmuskelzellen (Kardiomyozyten) ausgeschieden wird.
- GC32299 Bombinin-Like Peptide BLP-1 Bombinin-Like Peptide BLP-1 ist ein antimikrobielles Peptid der Bombina-Spezies.
- GC15099 Autocamtide-2-related inhibitory peptide Autocamtide-2-related inhibitory peptide ist ein hochspezifischer und potenter Inhibitor von CaMKII mit einem IC50 von 40 nM.
-
GC68908
C-Type Natriuretic Peptide (1-53), human TFA
C-Typ Natriuretisches Peptid (1-53), humanes TFA ist ein Fragment des C-Typs Natriuretisches Peptids. C-Type Natriuretic Peptide TFA gehört zur Familie der natriuretischen Peptide und ist an der Aufrechterhaltung des Elektrolyt-Flüssigkeitsgleichgewichts und des Gefäßtonus beteiligt.
- GC63766 G-Protein antagonist peptide TFA G-Protein-Antagonist-Peptid TFA ist ein verkÜrztes, mit der Substanz P verwandtes Peptid, das mit dem Rezeptor um die G-Protein-Bindung konkurriert.
- GC36893 Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa Phe-Met-Arg-Phe-Ähnliches Peptid, Snail Helix aspersa ist ein FMRF-Ähnliches Peptid aus viszeralen und somatischen Muskeln der Schnecke Helix aspersa.
- GC35426 Atrial Natriuretic Peptide (ANP) (1-28), rat TFA Atriales natriuretisches Peptid (ANP) (1-28), Ratte (TFA) ist eine in Ratten zirkulierende Hauptform von ANP und hemmt wirksam die durch Angiotensin II (Ang II) stimulierte Endothelin-1-Sekretion in einer konzentrationsabhÄngigen Weise.
- GC44654 PKCα (C2-4) Inhibitor Peptide The C2 domain of conventional PKC isoforms mediates calcium-dependent translocation.
- GC34396 Calcitonin Gene Related Peptide (CGRP) (83-119), rat
- GC34395 Calcitonin Gene Related Peptide (CGRP) (83-119), rat TFA
- GC34025 Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate Atriales natriuretisches Peptid (ANP) (1-28), human, porcines Acetat (Atriales natriuretisches Peptid (ANP) (1-28), humanes, porcines Acetat) ist ein 28-AminosÄuren-Hormon, das normalerweise von produziert und ausgeschieden wird menschliches Herz als Reaktion auf Herzverletzung und mechanische Dehnung.
- GC33599 PAR-4 Agonist Peptide, amide TFA (PAR-4-AP (TFA)) PAR-4-Agonist-Peptid, Amid TFA (PAR-4-AP (TFA)) (PAR-4-AP TFA; AY-NH2 TFA) ist ein Proteinase-aktivierter Rezeptor-4 (PAR-4)-Agonist, der keine Wirkung hat auf entweder PAR-1 oder PAR-2 und deren Wirkungen durch einen PAR-4-Antagonisten blockiert werden.
-
GP10112
TRH Precursor Peptide
Thyrotropin Releasing Hormone Precursor Peptide
- GC52476 Bax Inhibitor Peptide V5 (trifluoroacetate salt) A Bax inhibitor
- GC61345 Transdermal Peptide Disulfide TFA Transdermales Peptiddisulfid TFA (TD 1 Disulfid(peptid) TFA) ist ein Peptid aus 11 AminosÄuren, bindet an Na+/K+-ATPase Beta-Untereinheit (ATP1B1) und interagiert hauptsÄchlich mit dem C-Terminus von ATP1B1.
- GC38873 α2β1 Integrin Ligand Peptide TFA
- GC38869 Transdermal Peptide TFA
- GC32787 iRGD peptide (c(CRGDKGPDC)) Das iRGD-Peptid (c(CRGDKGPDC)) ist ein zyklisches Peptid aus 9 AminosÄuren, das die Gewebepenetration von Arzneimitteln auslÖst, indem es zuerst an av-Integrine bindet und dann im Tumor proteolytisch gespalten wird, um CRGDK/R zu produzieren, das mit Neuropilin-1 interagiert, und hat einen Tumor -zielgerichtete und tumordurchdringende Eigenschaften.
- GC31194 Small Cardioactive Peptide B SCPB Kleines kardioaktives Peptid B SCPB, ein neural aktives Peptid, stimuliert die Adenylatcyclase-Aktivität in partikulären Fraktionen von Herz- und Kiemengewebe mit EC50-Werten von 0,1 bzw. 1,0 μM.
- GC30633 Handle region peptide, rat Handle-Region-Peptid, Ratte ist ein Prorenin-Rezeptor-Antagonist, unterdrÜckt das Fortschreiten der diabetischen Nephropathie und wirkt entzÜndungshemmend im Auge.
- GC15525 cGMP Dependent Kinase Inhibitor Peptide cGMP Dependent Kinase Inhibitor Peptide ist ein ATP-kompetitiver Inhibitor der cGMP-abhÄngigen Proteinkinase (PKG) mit einem Ki von 86 μM.
- GP10085 Thrombin Receptor Activator for Peptide 5 (TRAP-5)
- GP10124 Anti-Inflammatory Peptide 1
- GP10101 Beta-Sheet Breaker Peptide iAβ5
- GC16695 Bax inhibitor peptide, negative control Peptide inhibit Bax translocation to mitochondria
- GC42803 Amyloid-β (25-35) Peptide (human) (trifluoroacetate salt) Amyloid-β (25-35) (Aβ (25-35)) is an 11-residue fragment of the Aβ protein that retains the physical and biological characteristics of the full length peptide.
- GC37036 PTD-p65-P1 Peptide PTD-p65-P1-Peptid ist ein potenter, selektiver nukleÄrer Transkriptionsfaktor-NF-κB-Inhibitor und stammt von der p65-Untereinheit der NF-κB-AminosÄurereste 271-282, die selektiv die NF-κB-Aktivierung hemmt, die durch verschiedene entzÜndliche Stimulation, Down- regulieren die NF-κB-vermittelte Genexpression und regulieren die Apoptose hoch.
- GC46851 Amyloid-β (1-42) Peptide (trifluoroacetate salt) A 42-amino acid protein fragment of amyloid-β
- GC36151 Glucagon-Like Peptide (GLP) II, human Glucagon-Like Peptide (GLP) II, human, ist ein Peptid mit 33 AminosÄuren, das vom C-Terminus von Proglucagon abgeleitet ist und hauptsÄchlich von den L-Zellen des Darms produziert wird.
- GC17589 HIV-1 Tat Protein Peptide Cell-penetrating peptide
- GC65375 Phospho-Glycogen Synthase Peptide-2(substrate) TFA Phospho-Glykogen-Synthase-Peptid-2 (Substrat) ist ein Peptidsubstrat fÜr Glykogen-Synthase-Kinase-3 (GSK-3) und kann zur AffinitÄtsreinigung von Protein-Serin-Kinasen verwendet werden.
- GC36296 IFN-α Receptor Recognition Peptide 1 IFN-α Rezeptorerkennungspeptid 1 ist ein Peptid von IFN-α, das mit Rezeptorwechselwirkungen assoziiert ist.
- GC36152 Glucagon-like peptide 1 (1-37), human (TFA)
- GC35756 C-Type Natriuretic Peptide (1-53), human Natriuretisches Peptid vom C-Typ (1-53), human, ist das 1-53-Fragment des natriuretischen Peptids vom C-Typ.
- GC35432 Autocamtide-2-related inhibitory peptide (TFA)
- GC34239 RNAIII-inhibiting peptide(TFA) RNAIII-inhibierendes Peptid (TFA) ist ein potenter Inhibitor von Staphylococcus aureus, wirksam bei Krankheiten wie Zellulitis, Keratitis, septischer Arthritis, Osteomylitis und Mastitis.
- GC17195 Bax inhibitor peptide V5 A Bax inhibitor
- GC62702 RAGE antagonist peptide TFA Das RAGE-Antagonistenpeptid TFA ist ein Antagonist fÜr fortgeschrittene Glykationsendprodukte (RAGE).
- GC61593 DAPK Substrate Peptide TFA DAPK-Substratpeptid TFA ist ein synthetisches Peptidsubstrat fÜr die mit dem Tod assoziierte Proteinkinase (DAPK) mit einem Km von 9 μM.
- GC37975 α2β1 Integrin Ligand Peptide α&2#946;1 Integrin-Ligand-Peptid interagiert mit dem α2β1-Integrin-Rezeptor auf der Zellmembran und vermittelt extrazelluläre Signale in die Zellen.
- GC36733 NGR peptide Trifluoroacetate NGR-Peptid Trifluoracetat, das das Asparagin-Glycin-Arginin (NGR)-Motiv enthÄlt, wird von CD13/Aminopeptidase N (APN)-Rezeptor-Isoformen erkannt, die selektiv in Neovaskulatur von Tumoren Überexprimiert werden.
- GC36301 IKKγ NBD Inhibitory Peptide IKKγ Das NBD-Inhibitorpeptid ist ein NEMO-Bindungsdomänen-Peptid (NBD-Peptid), das der aminoterminalen alpha-helikalen NEMO-Region entspricht, von der gezeigt wurde, dass sie die TNF-alpha-induzierte NF-kB-Aktivierung blockiert.
- GC34219 ATWLPPR Peptide TFA ATWLPPR-Peptid TFA, ein Heptapeptid, wirkt als selektiver Neuropilin-1-Inhibitor, hemmt die VEGF165-Bindung an NRP-1, das in der Erforschung der Angiogenese eingesetzt wird.
- GC14926 NGR peptide Cell-penetrating peptide
-
GC69639
OVA-E1 peptide TFA
OVA-E1 Peptid TFA ist ein Antagonist-Mutant von SIINFEKL [OVA (257-264)]. OVA-E1 Peptid aktiviert die p38 und JNK Kaskade in mutierten und wildtypischen Thymozyten.
- GA23633 T-Peptide T-Peptid, ein Tuftsin-Analogon, kann fÜr die Erforschung einer Infektion mit dem humanen ImmunschwÄchevirus (HIV) verwendet werden.
- GA23328 Osteogenic Growth Peptide (10-14) Osteogenes Wachstumspeptid (10-14) (OGP(10-14)), das C-terminal verkÜrzte Pentapeptid des osteogenen Wachstumspeptids (OGP), behÄlt die volle OGP-Ähnliche AktivitÄt.
- GC44536 PACAP-related Peptide (rat) (trifluoroacetate salt) PACAP-related peptide (PRP) is an endogenous 29-amino acid peptide that belongs to the secretin/glucagon superfamily of peptides, which includes secretin, glucagon, glucagon-like peptide-1, GLP-2, and pituitary adenylate cyclase-activating polypeptide.
- GC44535 PACAP-related Peptide (human) (trifluoroacetate salt) PACAP-related peptide (PRP) is an endogenous 29-amino acid peptide that belongs to the secretin/glucagon superfamily of peptides, which includes secretin, glucagon, glucagon-like peptide-1, GLP-2, and pituitary adenylate cyclase-activating polypeptide.
- GC44987 TAMRA-Amyloid-β (1-42) Peptide (trifluoroacetate salt) TAMRA-Amyloid-β (1-42) peptide is a fluorescently labeled peptide.
- GC52371 Vimentin (G146R) (139-159)-biotin Peptide A biotinylated mutant vimentin peptide
- GC42937 Biotin-Amyloid-β (1-42) Peptide (trifluoroacetate salt) Biotin-amyloid-β (1-42) peptide is an affinity probe that allows amyloid-β (1-42) (Aβ42) to be detected or immobilized through interaction with the biotin ligand.
- GC42801 Amyloid-β (1-8) Peptide Amyloid-β (1-8) is a wild-type control for the mutation-containing amyloid-β (1-8, A2V) peptide .
- GC10184 RGD (Arg-Gly-Asp) Peptides RGD (Arg-Gly-Asp)-Peptide sind Tripeptide, die effektiv die ZelladhÄsion auslÖsen, bestimmte Zelllinien ansprechen und spezifische Zellreaktionen hervorrufen; bindet an Integrine.
- GC35334 Amyloid β Peptide (42-1)(human) Amyloid β Peptid (42-1) (Mensch) ist die inaktive Form von Amyloid β Peptid (1-42).
- GC42802 Amyloid-β (1-8, A2V) Peptide Amyloid-β (1-8, A2V) is a truncated form of amyloid-β (Aβ) that contains a valine to alanine substitution at position 2 of the Aβ numbering convention (Aβ A2V), which corresponds to position 673 of the amyloid precursor protein (APP) numbering convention (APP A673V).
- GC10693 c-JUN peptide JNK/c-Jun interaction inhibitor
- GC26088 YAP-TEAD Inhibitor 1 (Peptide 17) YAP-TEAD Inhibitor 1 (Peptide 17) is a YAP-TEAD protein-protein interaction inhibitor which has potential usage in treatment of YAP-involved cancers with IC50 of 25 nM.