Alzheimer
Alzheimer
Alzheimer’s disease (AD), a neurodegenerative disorder, is the most common cause of progressive dementia. Two microscopic characteristics of AD are extracellular amyloid plaques and intracellular neurofibrillary tangles. Amyloid β peptide (Aβ), derived from amyloid precursor protein (APP) by sequential protein cleavage, and other metabolites deposit around neurons and form amyloid plaques, which contribute to the disease’s pathogenesis. The neurofibrillary tangles are formed by the aggregation of phosphorylated tau proteins. Under pathogenic conditions, tau accumulates in dendritic spines and interferes with neurotransmission. The Aβoligomer promotes tau enrichment and facilitates disease progress.
Produkte für Alzheimer
- Bestell-Nr. Artikelname Informationen
- GC11965 (±)-Huperzine A A neuroprotective AChE inhibitor
- GC46451 16F16 A PDI inhibitor
- GC18817 3β-hydroxy-5-Cholestenoic Acid 3β-hydroxy-5-Cholestenoic acid is an active metabolite of cholesterol formed when cholesterol is metabolized by the cytochrome P450 (CYP) isomer CYP27A1.
- GC40053 5α,6α-epoxy Cholestanol An oxysterol and a metabolite of cholesterol produced by oxidation
- GC52172 5-hydroxy Indole-3-acetic Acid-d6
- GC46720 6,9-Dichloro-1,2,3,4-tetrahydroacridine A synthetic intermediate in the synthesis of AChE inhibitors
- GC42584 6-O-desmethyl Donepezil 6-O-desmethyl Donepezil is an active metabolite of the acetylcholinesterase inhibitor donepezil.
- GC40587 8,12-iso-iPF2α-VI 8,12-iso-iPF2α-VI is an isoprostane produced by non-enzymatic, free radical-induced peroxidative damage to membrane lipids.
- GC45378 Alaproclate (hydrochloride)
- GC40024 Altenusin Altenusin zeigt ausgeprÄgte DPPH-RadikalfÄngeraktivitÄten.
- GC42796 Amylin (human) (trifluoroacetate salt) Amylin is a 37-residue peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety.
- GP10099 amyloid A protein fragment [Homo sapiens] Apolipoproteins related to HDL in plasma
-
GP10118
Amyloid Beta-Peptide (1-40) (human)
Amyloid β-Peptid (1-40) (human), (C194H295N53O58S1), ist ein Peptid mit der Sequenz H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid-Beta (Aβ oder Abeta) ist ein Peptid von 36–43 Aminosäuren, das aus dem Amyloid-Vorläuferprotein verarbeitet wird.
- GP10049 Amyloid Beta-Peptide (12-28) (human)
-
GP10082
Amyloid Beta-peptide (25-35) (human)
Amyloid-Beta-Peptid (25-35) (human) ist ein Fragment des Alzheimer Amyloid-Beta-Peptids, das neurotoxische Effekte hat.
-
GP10046
Amyloid Precursor C-Terminal Peptide
For beta amyloid generation
- GP10057 Amyloid β-Peptide (10-20) (human)
- GP10094 Amyloid β-peptide (10-35), amide
- GP10097 Amyloid β-Protein (1-15)
- GC46851 Amyloid-β (1-42) Peptide (trifluoroacetate salt) A 42-amino acid protein fragment of amyloid-β
- GC42801 Amyloid-β (1-8) Peptide Amyloid-β (1-8) is a wild-type control for the mutation-containing amyloid-β (1-8, A2V) peptide .
- GC42802 Amyloid-β (1-8, A2V) Peptide Amyloid-β (1-8, A2V) is a truncated form of amyloid-β (Aβ) that contains a valine to alanine substitution at position 2 of the Aβ numbering convention (Aβ A2V), which corresponds to position 673 of the amyloid precursor protein (APP) numbering convention (APP A673V).
- GC42803 Amyloid-β (25-35) Peptide (human) (trifluoroacetate salt) Amyloid-β (25-35) (Aβ (25-35)) is an 11-residue fragment of the Aβ protein that retains the physical and biological characteristics of the full length peptide.
- GP10083 Beta-Amyloid (1-11)
- GP10101 Beta-Sheet Breaker Peptide iAβ5
- GC42937 Biotin-Amyloid-β (1-42) Peptide (trifluoroacetate salt) Biotin-amyloid-β (1-42) peptide is an affinity probe that allows amyloid-β (1-42) (Aβ42) to be detected or immobilized through interaction with the biotin ligand.
- GC46997 C22 Galactosylceramide (d18:1/22:0) A sphingolipid
- GC43274 Citromycetin Citromycetin ist eine aromatische Polyketidverbindung aus dem australischen Meerwasser stammenden und terrestrischen Penicillium spp.
- GP10010 COG 133
- GC43322 CRANAD 28 CRANAD 28 ist eine robuste fluoreszierende Verbindung zur Visualisierung von Amyloid-Beta-Plaques.
- GC49557 Cu-GTSM A copper-containing compound with diverse biological activities
-
GC12942
DAPT (GSI-IX)
Inhibitor von γ-Sekretase
- GC49913 Davunetide (acetate) A neuroprotective ADNP-derived peptide
- GC45765 Deferiprone-d3 An internal standard for the quantification of deferiprone
- GC47186 Deoxy Donepezil (hydrochloride) A potential impurity found in bulk preparations of donepezil
- GC43494 DL-threo-PDMP (hydrochloride) DL-threo PDMP is a mixture of ceramide analogs that contains two of the four possible stereoisomers of PDMP : D-threo (1R,2R) and L-threo (1S,2S) PDMP.
- GC47263 Donecopride (fumarate hydrate) A 5-HT4 receptor partial agonist and AChE inhibitor
- GC40018 Donepezil N-oxide Donepezil N-oxide is an active metabolite of the acetylcholinesterase inhibitor donepezil.
- GC47264 Donepezil-d4 (hydrochloride) An internal standard for the quantification of donepezil
- GC43700 FSB FSB ist ein fluoreszierender Farbstoff, der zum Nachweis von filamentÖsem Tau und zur Markierung menschlicher AmyloidlÄsionen mit hoher Empfindlichkeit und SpezifitÄt (Anregung: 390 nm, Emission: 520 nm) verwendet werden kann.
- GC43708 Fulvic Acid FulvinsÄure ist ein Naturprodukt, das aus Huminstoffen gewonnen wird, die von Mikroorganismen im Boden produziert werden.
- GC52047 Fustin Fustinis ((±)-Fustin; 3,7,3',4'-Tetrahydroxyflavanon) ist ein starker Amyloid-β(Aβ)-Inhibitor.
- GC52078 Galantamine (hydrobromide) An alkaloid with AChE inhibitory and nAChR potentiating activities
- GC47389 Galantamine-d3 (hydrobromide) An internal standard for the quantification of galantamine
- GC49273 Glycerophosphorylethanolamine (sodium salt) An active metabolite of phosphatidylethanolamine
- GC49493 IRL 1620 (trifluoroacetate salt) A peptide ETB receptor agonist
- GC52027 Isolariciresinol Isolariciresinol ((+)-Cyclolariciresinol) kann zur Erforschung von Rheuma eingesetzt werden.
- GC49306 Isopimaric Acid IsopimarsÄure ist ein potenter Öffner von Calcium-aktivierten K+ (BK)-KanÄlen mit großer LeitfÄhigkeit.
- GC18568 JNJ-40418677 JNJ-40418677 ist ein oral aktiver Modulator der γ-Sekretase, der die Blut-Hirn-Schranke passieren kann.
- GC49436 L-3-n-Butylphthalide A phthalide with antiplatelet and neuroprotective activities
- GC47563 L-Glutamic Acid (ammonium salt) An excitatory neurotransmitter
- GC49417 L-Serine-13C3 L-Serin-13C3 ((-)-Serin-13C3) ist das 13C-markierte L-Serin. L-Serin ((-)-Serin; (S)-Serin), eine der sogenannten nicht-essentiellen AminosÄuren, spielt eine zentrale Rolle bei der Zellproliferation.
- GC49461 L-Serine-d7 An internal standard for the quantification of L-serine
- GC45917 Leucettine L41 Leucettin L41 ist ein potenter Inhibitor der dualspezifischen Tyrosin-Phosphorylierungs-regulierten Kinase 1A (DYRK1A), DYRK2, CDC-Ähnlicher Kinase 1 (CLK1) und CLK3 (IC50s = 0,04, 0,035, 0,015 bzw. 4,5 μM)[1 ].
- GC19221 Leucomethylene blue Mesylate Leucomethylenblau (TRx0237)-Mesylat, ein oral aktiver Tau-Protein-Aggregationsinhibitor der zweiten Generation (Ki von 0,12 μM), kÖnnte fÜr die Untersuchung der Alzheimer-Krankheit verwendet werden.
- GC40078 Memantine-d6 (hydrochloride) Memantine-d6 is intended for use as an internal standard for the quantification of memantine by GC- or LC-MS.
- GC44225 ML-345 ML-345 ist ein potenter und selektiver niedermolekularer Inhibitor des insulinabbauenden Enzyms (IDE) mit einem IC50-Wert von 188 nM.
- GP10006 Myelin Basic Protein (68-82), guinea pig
-
GP10130
Myelin Basic Protein (87-99)
An encephalitogenic peptide
-
GC44416
N-methyl Mesoporphyrin IX
Ein Ferrochelatase-Inhibitor und Biosensor zur Aktivierung von DNA.
- GC47746 NAP 226-90 A metabolite of rivastigmine
- GC44399 NIAD-4 NIAD-4 is a fluorescent probe that crosses the blood-brain barrier to bind with high affinity to amyloid-β (Aβ) plaques (Ki = 10 nM).
-
GC52214
Nicotinamide riboside-d4 (triflate)
An internal standard for the quantification of nicotinamide riboside
- GC49090 Nilvadipine-d4 An internal standard for the quantification of nilvadipine
- GC49815 Oleuropein aglycone A polyphenol with diverse biological activities
- GC49024 Palmitic Acid MaxSpec® Standard A quantitative analytical standard guaranteed to meet MaxSpec® identity, purity, stability, and concentration specifications
- GC49023 Palmitic Acid-d9 MaxSpec® Standard A quantitative analytical standard guaranteed to meet MaxSpec® identity, purity, stability, and concentration specifications
- GC47955 Phloroglucinol A phenol with diverse biological activities
- GC49192 Piracetam-d6 An internal standard for the quantification of piracetam
- GC48362 PMX-205 (trifluoroacetate salt) A potent antagonist of C5aR
- GC44674 Pramlintide (acetate hydrate) Pramlintide is a non-amyloidogenic analog of the antidiabetic peptide hormone amylin that contains proline residues substituted at positions 25, 28, and 29.
- GC46208 Propentofylline Propentofyllin ist ein Xanthin-Derivat, das die Aufnahme von Adenosin hemmt und die Phosphodiesterase-AktivitÄt blockiert.
- GC49108 Racecadotril-d5 An internal standard for the quantification of racecadotril
- GC48028 Rasagiline-13C3 (mesylate) An internal standard for the quantification of rasagiline
- GC18483 RU-505 RU-505 is an inhibitor of the interaction between amyloid-β (Aβ) and fibrinogen, with a higher efficacy for inhibiting monomeric forms of Aβ bound to fibrinogen over oligomeric forms.
- GC12096 Semagacestat (LY450139) A pan γ-secretase inhibitor
- GC40068 Setosusin Setosusin ((+)-Setosusin) ist ein pilzliches Meroditerpenoid mit einer einzigartigen spirokondensierten 3(2H)-Furanon-Einheit.
- GC45831 SRI-011381 SRI-011381 ist ein oral aktiver TGF-β-Signalagonist mit neuroprotektiven Wirkungen.
- GC52496 Sulfatide (bovine) (sodium salt) A mixture of isolated bovine sulfatides
- GC44968 Sulfatides (bovine) (sodium salt) Sulfatides are endogenous sulfoglycolipids with various biological activities in the central and peripheral nervous systems, pancreas, and immune system.
- GC44987 TAMRA-Amyloid-β (1-42) Peptide (trifluoroacetate salt) TAMRA-Amyloid-β (1-42) peptide is a fluorescently labeled peptide.
- GC45137 Valproic Acid Acyl-D-Glucuronide Valproic acid acyl-D-glucuronide is the major urinary metabolite of valproic acid.
- GC48969 Withanone Withanon ist ein Wirkstoff aus Withania somnifera-Wurzeln mit multifunktionaler neuroprotektiver Wirkung bei der Linderung kognitiver Dysfunktionen.