Search Site
  • 0
    Mein Warenkorb

    Hier klicken, um die Anzahl der von Ihnen hinzugefügten Artikel zu sehen:)

    image loader

    Artikel in den Warenkorb legen......

Startseite >> Signaling Pathways >> Neuroscience >> Alzheimer

Alzheimer

Alzheimer

Alzheimer

Alzheimer’s disease (AD), a neurodegenerative disorder, is the most common cause of progressive dementia. Two microscopic characteristics of AD are extracellular amyloid plaques and intracellular neurofibrillary tangles. Amyloid β peptide (Aβ), derived from amyloid precursor protein (APP) by sequential protein cleavage, and other metabolites deposit around neurons and form amyloid plaques, which contribute to the disease’s pathogenesis. The neurofibrillary tangles are formed by the aggregation of phosphorylated tau proteins. Under pathogenic conditions, tau accumulates in dendritic spines and interferes with neurotransmission. The Aβoligomer promotes tau enrichment and facilitates disease progress.

Produkte für  Alzheimer

  1. Bestell-Nr. Artikelname Informationen
  2. GC11965 (±)-Huperzine A

    Hup A, (-)-Selagine

     A neuroprotective AChE inhibitor (±)-Huperzine A Chemical Structure
  3. GC26199 1-heptadecanoyl-2-hydroxy-sn-glycero-3-phosphocholine 1-heptadecanoyl-2-hydroxy-sn-glycero-3-phosphocholine Chemical Structure
  4. GC46451 16F16 A PDI inhibitor 16F16 Chemical Structure
  5. GC65195 2-O-Acetyl-20-hydroxyecdysone

    β-Ecdysone 2-acetate

     2-O-Acetyl-20-hydroxyecdyson, ein Ecdysteron in Insekten und Landpflanzen, hemmt die durch Amyloid-β42 (Aβ42) induzierte ZytotoxizitÄt. 2-O-Acetyl-20-hydroxyecdysone Chemical Structure
  6. GC18817 3β-hydroxy-5-Cholestenoic Acid

    3β-hydroxy-5-CA, Cholesterol-26-carboxylic Acid

     3β-hydroxy-5-Cholestenoic acid is an active metabolite of cholesterol formed when cholesterol is metabolized by the cytochrome P450 (CYP) isomer CYP27A1. 3β-hydroxy-5-Cholestenoic Acid Chemical Structure
  7. GC40053 5α,6α-epoxy Cholestanol

    NSC 18176

     An oxysterol and a metabolite of cholesterol produced by oxidation 5α,6α-epoxy Cholestanol Chemical Structure
  8. GC52172 5-hydroxy Indole-3-acetic Acid-d6

    5-HIAA-d6, 5-Hydroxyindoleacetic Acid-d6, 5-hydroxy IAA-d6

     5-hydroxy Indole-3-acetic Acid-d6 Chemical Structure
  9. GC46720 6,9-Dichloro-1,2,3,4-tetrahydroacridine

    NSC 1227

     A synthetic intermediate in the synthesis of AChE inhibitors 6,9-Dichloro-1,2,3,4-tetrahydroacridine Chemical Structure
  10. GC42584 6-O-desmethyl Donepezil 6-O-desmethyl Donepezil is an active metabolite of the acetylcholinesterase inhibitor donepezil. 6-O-desmethyl Donepezil Chemical Structure
  11. GC40587 8,12-iso-iPF2α-VI

    8,12-iso-Isoprostane-F2α-VI, 12-iso-5,6E,14Z-PGF2α, 12iso5,6E,14ZProstaglandin F2α

     8,12-iso-iPF2α-VI is an isoprostane produced by non-enzymatic, free radical-induced peroxidative damage to membrane lipids. 8,12-iso-iPF2α-VI Chemical Structure
  12. GC45378 Alaproclate (hydrochloride)

    GEA 654, A03

       Alaproclate (hydrochloride) Chemical Structure
  13. GC40024 Altenusin

    Alutenusin

     Altenusin zeigt ausgeprÄgte DPPH-RadikalfÄngeraktivitÄten. Altenusin Chemical Structure
  14. GC42794 Amylin (8-37) (human) (trifluoroacetate salt)

    IAPP (8-37) (human), Islet Amyloid Polypeptide (8-37) (human)

     Amylin (8-37) is a peptide fragment of amylin. Amylin (8-37) (human) (trifluoroacetate salt) Chemical Structure
  15. GC42795 Amylin (human) (amidated) (trifluoroacetate salt)

    IAPP (human) (amidated), Islet Amyloid Polypeptide (human) (amidated)

     Amylin is a peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety. Amylin (human) (amidated) (trifluoroacetate salt) Chemical Structure
  16. GC42796 Amylin (human) (trifluoroacetate salt)

    IAPP (human), Islet Amyloid Polypeptide (human)

     Amylin is a 37-residue peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety. Amylin (human) (trifluoroacetate salt) Chemical Structure
  17. GP10099 amyloid A protein fragment [Homo sapiens]

    H2N-Ala-Gly-Leu-Pro-Glu-Lys-Tyr-OH

    Apolipoproteins related to HDL in plasma amyloid A protein fragment [Homo sapiens] Chemical Structure
  18. GP10118 Amyloid Beta-Peptide (1-40) (human)

    Amyloid β-Peptid (1-40) (human), (C194H295N53O58S1), ist ein Peptid mit der Sequenz H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid-Beta (Aβ oder Abeta) ist ein Peptid von 36–43 Aminosäuren, das aus dem Amyloid-Vorläuferprotein verarbeitet wird.

     Amyloid Beta-Peptide (1-40) (human) Chemical Structure
  19. GP10049 Amyloid Beta-Peptide (12-28) (human) Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)). Amyloid Beta-Peptide (12-28) (human) Chemical Structure
  20. GP10082 Amyloid Beta-peptide (25-35) (human)

    Amyloid-Beta-Peptid (25-35) (human) ist ein Fragment des Alzheimer Amyloid-Beta-Peptids, das neurotoxische Effekte hat.

     Amyloid Beta-peptide (25-35) (human) Chemical Structure
  21. GP10046 Amyloid Precursor C-Terminal Peptide

    H2N-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH

    For beta amyloid generation

     Amyloid Precursor C-Terminal Peptide Chemical Structure
  22. GP10057 Amyloid β-Peptide (10-20) (human)

    Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe

    Amyloid β-Peptide (10-20) (human) Chemical Structure
  23. GP10094 Amyloid β-peptide (10-35), amide

    H2N-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-NH2

    Amyloid β-peptide (10-35), amide Chemical Structure
  24. GP10097 Amyloid β-Protein (1-15)

    H2N-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-OH

    Amyloid β-Protein (1-15) Chemical Structure
  25. GC46851 Amyloid-β (1-42) Peptide (trifluoroacetate salt)

    Aβ (1-42), Aβ42

     A 42-amino acid protein fragment of amyloid-β Amyloid-β (1-42) Peptide (trifluoroacetate salt) Chemical Structure
  26. GC42801 Amyloid-β (1-8) Peptide

    Aβ (1-8)

     Amyloid-β (1-8) is a wild-type control for the mutation-containing amyloid-β (1-8, A2V) peptide . Amyloid-β (1-8) Peptide Chemical Structure
  27. GC42802 Amyloid-β (1-8, A2V) Peptide

    Aβ (1-8, A2V), Aβ (1-8) mutant, Amyloid-β (1-8) dominant negative

     Amyloid-β (1-8, A2V) is a truncated form of amyloid-β (Aβ) that contains a valine to alanine substitution at position 2 of the Aβ numbering convention (Aβ A2V), which corresponds to position 673 of the amyloid precursor protein (APP) numbering convention (APP A673V). Amyloid-β (1-8, A2V) Peptide Chemical Structure
  28. GC42803 Amyloid-β (25-35) Peptide (human) (trifluoroacetate salt)

    Aβ (25-35)

     Amyloid-β (25-35) (Aβ (25-35)) is an 11-residue fragment of the Aβ protein that retains the physical and biological characteristics of the full length peptide. Amyloid-β (25-35) Peptide (human) (trifluoroacetate salt) Chemical Structure
  29. GP10083 Beta-Amyloid (1-11)

    H2N-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-OH

    Beta-Amyloid (1-11) Chemical Structure
  30. GP10101 Beta-Sheet Breaker Peptide iAβ5

    H2N-Leu-Pro-Phe-Phe-Asp-OH

    Beta-Sheet Breaker Peptide iAβ5 Chemical Structure
  31. GC42937 Biotin-Amyloid-β (1-42) Peptide (trifluoroacetate salt)

    Biotin-Aβ (1-42), Biotin-Aβ42

     Biotin-amyloid-β (1-42) peptide is an affinity probe that allows amyloid-β (1-42) (Aβ42) to be detected or immobilized through interaction with the biotin ligand. Biotin-Amyloid-β (1-42) Peptide (trifluoroacetate salt) Chemical Structure
  32. GC46992 C18 Ganglioside GM1-d3 (d18:1/18:0-d3) (ammonium salt)

    N-omega-CD3-Octadecanoyl monosialoganglioside GM1-d3, N-CD3-Stearoyl-GM, C18 GM1-d3, GM1 (18:1/18:0-d3), GM1 (d18:1/C18:0)-d3, Monosialoganglioside GM1-d3, N-Stearoyl Monosialoganglioside GM1-d3

     A neuropeptide with diverse biological activities C18 Ganglioside GM1-d3 (d18:1/18:0-d3) (ammonium salt) Chemical Structure
  33. GC46997 C22 Galactosylceramide (d18:1/22:0)

    N-Docosanoyl-β-D-Galactosylceramide, Galactosylceramide (d18:1/22:0), GalCer(d18:1/22:0)

     A sphingolipid C22 Galactosylceramide (d18:1/22:0) Chemical Structure
  34. GC46998 C22 Galactosylceramide-d4 (d18:1/22:0-d4)

    Galactosylceramide-d4 (d18:1/22:0-d4), N-Docosanoyl-β-D-Galactosylceramide-d4, GalCer(d18:1/22:0-d4)

     A neuropeptide with diverse biological activities C22 Galactosylceramide-d4 (d18:1/22:0-d4) Chemical Structure
  35. GC91899 Carmustine-d8

    BCNU-d8; bis-Chloroethylnitrosourea-d8

     Carmustine-d8 ist als interner Standard für die Quantifizierung von Carmustin durch GC- oder LC-MS bestimmt. Carmustine-d8 Chemical Structure
  36. GC43274 Citromycetin

    NSC 53584

     Citromycetin ist eine aromatische Polyketidverbindung aus dem australischen Meerwasser stammenden und terrestrischen Penicillium spp. Citromycetin Chemical Structure
  37. GP10010 COG 133

    Leu-Arg-Val-Arg-Leu-Ala-Ser-His-Leu-Arg-Lys-Leu-Arg-Lys-Arg-Leu-Leu

    COG 133 Chemical Structure
  38. GC43304 Compound 43 TAO Kinase Inhibitor Compound 43 TAO kinase inhibitor is an ATP-competitive inhibitor of the thousand-and-one amino acid kinases TAOK1 and TAOK2 (IC50s = 11 and 15 nM, respectively). Compound 43 TAO Kinase Inhibitor Chemical Structure
  39. GC43322 CRANAD 28 CRANAD 28 ist eine robuste fluoreszierende Verbindung zur Visualisierung von Amyloid-Beta-Plaques. CRANAD 28 Chemical Structure
  40. GC49557 Cu-GTSM

    CuII(gtsm), copper-GTSM

     A copper-containing compound with diverse biological activities Cu-GTSM Chemical Structure
  41. GC12942 DAPT (GSI-IX)

    gamma-Secretase Inhibitor IX, DAPT, GSI-IX

    Inhibitor von γ-Sekretase

     DAPT (GSI-IX) Chemical Structure
  42. GC49913 Davunetide (acetate)

    AL-108, NAP, NAPVSIPQ

     A neuroprotective ADNP-derived peptide Davunetide (acetate) Chemical Structure
  43. GC41151 Decursinol angelate Decursinol angelate is a pyranocoumarin that has been found in the Korean medicinal herb A. Decursinol angelate Chemical Structure
  44. GC45765 Deferiprone-d3 An internal standard for the quantification of deferiprone Deferiprone-d3 Chemical Structure
  45. GC47186 Deoxy Donepezil (hydrochloride) A potential impurity found in bulk preparations of donepezil Deoxy Donepezil (hydrochloride) Chemical Structure
  46. GC47196 Desloratadine-d4

    Descarboethoxyloratadine-d4

     A neuropeptide with diverse biological activities Desloratadine-d4 Chemical Structure
  47. GC46134 Dityrosine (hydrochloride)

    Bityrosine, o,o-Ditryosine

     A neuropeptide with diverse biological activities Dityrosine (hydrochloride) Chemical Structure
  48. GC43494 DL-threo-PDMP (hydrochloride) DL-threo PDMP is a mixture of ceramide analogs that contains two of the four possible stereoisomers of PDMP : D-threo (1R,2R) and L-threo (1S,2S) PDMP. DL-threo-PDMP (hydrochloride) Chemical Structure
  49. GC47263 Donecopride (fumarate hydrate)

    MR31147

     A 5-HT4 receptor partial agonist and AChE inhibitor Donecopride (fumarate hydrate) Chemical Structure
  50. GC40018 Donepezil N-oxide Donepezil N-oxide is an active metabolite of the acetylcholinesterase inhibitor donepezil. Donepezil N-oxide Chemical Structure
  51. GC47264 Donepezil-d4 (hydrochloride) An internal standard for the quantification of donepezil Donepezil-d4 (hydrochloride) Chemical Structure
  52. GC43700 FSB FSB ist ein fluoreszierender Farbstoff, der zum Nachweis von filamentÖsem Tau und zur Markierung menschlicher AmyloidlÄsionen mit hoher Empfindlichkeit und SpezifitÄt (Anregung: 390 nm, Emission: 520 nm) verwendet werden kann. FSB Chemical Structure
  53. GC43708 Fulvic Acid FulvinsÄure ist ein Naturprodukt, das aus Huminstoffen gewonnen wird, die von Mikroorganismen im Boden produziert werden. Fulvic Acid Chemical Structure
  54. GC52047 Fustin

    Dihydrofisetin, NSC 59264

     Fustinis ((±)-Fustin; 3,7,3',4'-Tetrahydroxyflavanon) ist ein starker Amyloid-β(Aβ)-Inhibitor. Fustin Chemical Structure
  55. GC52078 Galantamine (hydrobromide)

    Galanthamine, NSC 100058

     An alkaloid with AChE inhibitory and nAChR potentiating activities Galantamine (hydrobromide) Chemical Structure
  56. GC47389 Galantamine-d3 (hydrobromide) An internal standard for the quantification of galantamine Galantamine-d3 (hydrobromide) Chemical Structure
  57. GC20007 Ginsenoside CK

    Ginsenoside Compound K, Ginsenoside IH901; Compound K

    Ginsenoside C-K, a bacterial metabolite of G-Rb1, exhibits anti-inflammatory effects by reducing iNOS and COX-2. Ginsenoside C-K exhibits an inhibition against the activity of CYP2C9 and CYP2A6 in human liver microsomes with IC50s of 32.0±3.6 μM and 63.6±4.2 μM, respectively.

     Ginsenoside CK Chemical Structure
  58. GC49273 Glycerophosphorylethanolamine (sodium salt)

    Glycerol 3-phosphorylethanolamine, Glycerylphosphorylethanolamine

     An active metabolite of phosphatidylethanolamine Glycerophosphorylethanolamine (sodium salt) Chemical Structure
  59. GC40114 Histone H3K4Me3 (1-10) (human, mouse, rat, porcine, bovine) (trifluoroacetate salt) Histone H3K4Me3 (1-10) is an N-terminal peptide fragment of histone H3 that corresponds to amino acid residues 2-11 of the human histone H3 sequence. Histone H3K4Me3 (1-10) (human, mouse, rat, porcine, bovine) (trifluoroacetate salt) Chemical Structure
  60. GC43858 Histone H3K4Me3 (1-21) (human, mouse, rat, porcine, bovine) (trifluoroacetate salt)

    ART-K(Me3)-QTARKSTGGKAPRKQLA, H3K4(Me3), Histone H3 (1-21) (Lys4me3), Lys(Me3)4-Histone H3 (1-21)

    Histone H3K4Me3 (1-21) is an N-terminal peptide fragment of histone H3 that corresponds to amino acid residues 2-22 of the human histone H3 sequence.

     Histone H3K4Me3 (1-21) (human, mouse, rat, porcine, bovine) (trifluoroacetate salt) Chemical Structure
  61. GC45480 Histone H3K4Me3 (1-25) amide (human mouse, rat, porcine, bovine) (trifluoroacetate salt)

    ART-K(Me3)-QTARKSTGGKAPRKQLATKAA-NH2, Histone H3 (1-25) (Lys4me3), H3K4me3, Lys(Me3)4-Histone H3 (1-25) amide

     Histone H3K4Me3 (1-25) amide (human mouse, rat, porcine, bovine) (trifluoroacetate salt) Chemical Structure
  62. GC47437 Humanin (human) (trifluoroacetate salt)

    HN

     A neuropeptide with diverse biological activities Humanin (human) (trifluoroacetate salt) Chemical Structure
  63. GC49493 IRL 1620 (trifluoroacetate salt)

    PMZ-1620, SPI 1620, Suc-Glu9, Ala11,15-ET-1(8-21)

     A peptide ETB receptor agonist IRL 1620 (trifluoroacetate salt) Chemical Structure
  64. GC52027 Isolariciresinol

    (+)-Cyclolariciresinol, (+)-Isolariciresinol, (7′S,8′R,8R)-Isolariciresinol

     Isolariciresinol ((+)-Cyclolariciresinol) kann zur Erforschung von Rheuma eingesetzt werden. Isolariciresinol Chemical Structure
  65. GC49306 Isopimaric Acid

    7,15-Isopimaradien-18-oic Acid, (+)-Isopimaric Acid

     IsopimarsÄure ist ein potenter Öffner von Calcium-aktivierten K+ (BK)-KanÄlen mit großer LeitfÄhigkeit. Isopimaric Acid Chemical Structure
  66. GC18568 JNJ-40418677 JNJ-40418677 ist ein oral aktiver Modulator der γ-Sekretase, der die Blut-Hirn-Schranke passieren kann. JNJ-40418677 Chemical Structure
  67. GC49436 L-3-n-Butylphthalide

    (-)-3-Butylphthalide, levo-3-n-Butylphthalide, (S)-(-)-3-Butylphthalide, L-NBP

     A phthalide with antiplatelet and neuroprotective activities L-3-n-Butylphthalide Chemical Structure
  68. GC47563 L-Glutamic Acid (ammonium salt)

    Glutamic Acid

     An excitatory neurotransmitter L-Glutamic Acid (ammonium salt) Chemical Structure
  69. GC49417 L-Serine-13C3

    (S)-Serine-13C3

     L-Serin-13C3 ((-)-Serin-13C3) ist das 13C-markierte L-Serin. L-Serin ((-)-Serin; (S)-Serin), eine der sogenannten nicht-essentiellen AminosÄuren, spielt eine zentrale Rolle bei der Zellproliferation. L-Serine-13C3 Chemical Structure
  70. GC49461 L-Serine-d7

    (S)-Serine-d7

     An internal standard for the quantification of L-serine L-Serine-d7 Chemical Structure
  71. GC45917 Leucettine L41 Leucettin L41 ist ein potenter Inhibitor der dualspezifischen Tyrosin-Phosphorylierungs-regulierten Kinase 1A (DYRK1A), DYRK2, CDC-Ähnlicher Kinase 1 (CLK1) und CLK3 (IC50s = 0,04, 0,035, 0,015 bzw. 4,5 μM)[1 ]. Leucettine L41 Chemical Structure
  72. GC19221 Leucomethylene blue Mesylate

    Hydromethylthionine, Leucomethylene Blue, Leukomethylthioninium dihydromesylate, LMTM

     Leucomethylenblau (TRx0237)-Mesylat, ein oral aktiver Tau-Protein-Aggregationsinhibitor der zweiten Generation (Ki von 0,12 μM), kÖnnte fÜr die Untersuchung der Alzheimer-Krankheit verwendet werden. Leucomethylene blue Mesylate Chemical Structure
  73. GC44130 Mca-EVKMDAEF-K(Dnp)-NH2 (ammonium salt)

    β-Secretase Fluorogenic Substrate

     Mca-EVKMDAEF-K(Dnp)-NH2 is a fluorogenic substrate for β-secretase. Mca-EVKMDAEF-K(Dnp)-NH2 (ammonium salt) Chemical Structure
  74. GC44131 Mca-HQKLVFFA-K(Dnp)-NH2 (trifluoroacetate salt)

    α-Secretase Fluorogenic Substrate

     Mca-HQKLVFFA-K(Dnp)-NH2 is a fluorogenic substrate for α-secretase. Mca-HQKLVFFA-K(Dnp)-NH2 (trifluoroacetate salt) Chemical Structure
  75. GC40078 Memantine-d6 (hydrochloride) Memantine-d6 is intended for use as an internal standard for the quantification of memantine by GC- or LC-MS. Memantine-d6 (hydrochloride) Chemical Structure
  76. GC44225 ML-345 ML-345 ist ein potenter und selektiver niedermolekularer Inhibitor des insulinabbauenden Enzyms (IDE) mit einem IC50-Wert von 188 nM. ML-345 Chemical Structure
  77. GP10006 Myelin Basic Protein (68-82), guinea pig Myelin Basic Protein (68-82), guinea pig Chemical Structure
  78. GP10130 Myelin Basic Protein (87-99)

    Val-His-Phe-Phe-Lys-Asn-Ile-Val-Thr-Pro-Arg-Thr-Pro

    An encephalitogenic peptide

     Myelin Basic Protein (87-99) Chemical Structure
  79. GC44416 N-methyl Mesoporphyrin IX

    Ein Ferrochelatase-Inhibitor und Biosensor zur Aktivierung von DNA.

     N-methyl Mesoporphyrin IX Chemical Structure
  80. GC47746 NAP 226-90 A metabolite of rivastigmine NAP 226-90 Chemical Structure
  81. GC44399 NIAD-4 NIAD-4 is a fluorescent probe that crosses the blood-brain barrier to bind with high affinity to amyloid-β (Aβ) plaques (Ki = 10 nM). NIAD-4 Chemical Structure
  82. GC52214 Nicotinamide riboside-d4 (triflate)

    An internal standard for the quantification of nicotinamide riboside

     Nicotinamide riboside-d4 (triflate) Chemical Structure
  83. GC49090 Nilvadipine-d4

    (±)-Nilvadipine-d4

     An internal standard for the quantification of nilvadipine Nilvadipine-d4 Chemical Structure
  84. GC72054 Obovatol Obovatol ist ein aus den Blättern der Magnolia obovata Thunb isolierter Biphenylether-Lignan. Obovatol Chemical Structure
  85. GC49815 Oleuropein aglycone

    3,4-DHPEA-EA

     A polyphenol with diverse biological activities Oleuropein aglycone Chemical Structure
  86. GC91070 p-methyl-N-salicyloyl Tryptamine

    Ein neuroprotektives Mittel

     p-methyl-N-salicyloyl Tryptamine Chemical Structure
  87. GC49024 Palmitic Acid MaxSpec® Standard

    C16:0, Cetylic Acid, NSC 5030

     A quantitative analytical standard guaranteed to meet MaxSpec® identity, purity, stability, and concentration specifications Palmitic Acid MaxSpec® Standard Chemical Structure
  88. GC49023 Palmitic Acid-d9 MaxSpec® Standard

    C16:0-d9, Cetylic Acid-d9

     A quantitative analytical standard guaranteed to meet MaxSpec® identity, purity, stability, and concentration specifications Palmitic Acid-d9 MaxSpec® Standard Chemical Structure
  89. GC39419 PBD-150 PBD-150 ist ein Inhibitor der humanen Glutaminylcyclase (hQC) Y115E-Y117E-Variante mit einem Ki-Wert von 490 nM. PBD-150 Chemical Structure
  90. GC47955 Phloroglucinol

    Benzene-s-triol, 1,3,5-Hydroxybenzene, NSC 1572, 1,3,5-Trihydroxybenzene, sym-Trihydroxybenzene

     A phenol with diverse biological activities Phloroglucinol Chemical Structure
  91. GC49192 Piracetam-d6

    UCB-6215-d6

     An internal standard for the quantification of piracetam Piracetam-d6 Chemical Structure
  92. GC48362 PMX-205 (trifluoroacetate salt) A potent antagonist of C5aR PMX-205 (trifluoroacetate salt) Chemical Structure
  93. GC44674 Pramlintide (acetate hydrate) Pramlintide is a non-amyloidogenic analog of the antidiabetic peptide hormone amylin that contains proline residues substituted at positions 25, 28, and 29. Pramlintide (acetate hydrate) Chemical Structure
  94. GC46208 Propentofylline

    HOE 285, HWA 285

     Propentofyllin ist ein Xanthin-Derivat, das die Aufnahme von Adenosin hemmt und die Phosphodiesterase-AktivitÄt blockiert. Propentofylline Chemical Structure
  95. GC49108 Racecadotril-d5

    Acetorphan-d5

     An internal standard for the quantification of racecadotril Racecadotril-d5 Chemical Structure
  96. GC48028 Rasagiline-13C3 (mesylate) An internal standard for the quantification of rasagiline Rasagiline-13C3 (mesylate) Chemical Structure
  97. GC18483 RU-505 RU-505 is an inhibitor of the interaction between amyloid-β (Aβ) and fibrinogen, with a higher efficacy for inhibiting monomeric forms of Aβ bound to fibrinogen over oligomeric forms. RU-505 Chemical Structure
  98. GC19799 Selegiline hydrochloride

    R(-)-Deprenyl hydrochloride;R(-)-Deprenyl hydrochloride

    Selegiline hydrochloride is a selective, reversible inhibitor of MAO-B (Ki = 0.091 μM) over MAO-A (Ki = 9.06 μM). Monoamine oxidase (MAO) inhibitors have utility in ameliorating a variety of neurological conditions, including depression.

     Selegiline hydrochloride Chemical Structure
  99. GC12096 Semagacestat (LY450139)

    LY450139

     A pan γ-secretase inhibitor Semagacestat (LY450139) Chemical Structure
  100. GC40068 Setosusin

    (+)-Setosusin

     Setosusin ((+)-Setosusin) ist ein pilzliches Meroditerpenoid mit einer einzigartigen spirokondensierten 3(2H)-Furanon-Einheit. Setosusin Chemical Structure
  101. GC48083 sn-Glycerol-3-phosphate (cyclohexyl ammonium salt hydrate)

    G3P

     A neuropeptide with diverse biological activities sn-Glycerol-3-phosphate (cyclohexyl ammonium salt hydrate) Chemical Structure

Artikel 1 bis 100 von 109 gesamt

pro Seite
  1. 1
  2. 2

Absteigend sortieren