Search Site
  • 0
    Mein Warenkorb

    Hier klicken, um die Anzahl der von Ihnen hinzugefügten Artikel zu sehen:)

    image loader

    Artikel in den Warenkorb legen......

Startseite >> Signaling Pathways >> Neuroscience >> Amyloid β

Amyloid β

Amyloid β denotes peptides of 36–43 amino acids result from the APP (amyloid precursor protein) and are involved in Alzheimer's disease as the main component of the amyloid plaques.

Produkte für  Amyloid β

  1. Bestell-Nr. Artikelname Informationen
  2. GC63273 β-Amyloid (1-14),mouse,rat β-Amyloid (1-14),mouse,rat Chemical Structure
  3. GC66089 β-Amyloid (1-40) (TFA)

    Amyloid Beta-Peptide (1-40) (human) TFA; Amyloid β-Peptide (1-40) (human) TFA

     β-Amyloid (1-40) TFA ist ein primÄres Protein in Plaques, die im Gehirn von Patienten mit Alzheimer-Krankheit gefunden werden. β-Amyloid (1-40) (TFA) Chemical Structure
  4. GC70182 β-Amyloid (1-40), FAM-labeled TFA

    β-Amyloid (1-40), FAM-markiert TFA ist ein mit FAM markiertes fluoreszierendes Peptid von β-Amyloid (1-40) (Λex= 492 nm und Λem= 518 nm).

     β-Amyloid (1-40), FAM-labeled TFA Chemical Structure
  5. GC63274 β-Amyloid (1-42), (rat/mouse) (TFA)

    Amyloid β-peptide (1-42) (rat/mouse) TFA

     β-Amyloid (1-42), (rat/mouse) (TFA) Chemical Structure
  6. GC37984 β-Amyloid (1-42), rat

    Amyloid β-peptide (1-42) (rat/mouse)

     β-Amyloid (1-42), Ratte, ist ein Peptid mit 42 AminosÄuren, zeigt eine zytotoxische Wirkung auf akute Hippocampus-Schnitte und wird in der Erforschung der Alzheimer-Krankheit verwendet. β-Amyloid (1-42), rat Chemical Structure
  7. GC66416 β-Amyloid (22-35) (TFA)

    Amyloid β-Protein (22-35) (TFA)

     β-Amyloid 22-35 (Amyloid β-Protein 22-35) TFA, das Fragment der Reste 22-35 von β-Amyloid-Protein, hat eine zytotoxische Wirkung auf kultivierte Neuronen aus dem Hippocampus der Ratte in serumfreiem Medium. β-Amyloid 22-35 TFA bildet Aggregate und typische Amyloidfibrillen, die denen des &7#946;-Amyloidproteins in neutraler PufferlÖsung Ähneln). β-Amyloid (22-35) (TFA) Chemical Structure
  8. GC66346 β-Amyloid (42-1), human TFA

    Amyloid β Peptide (42-1)(human) TFA

     β-Amyloid (42-1), menschliches TFA ist die inaktive Form von Amyloid β Peptid (1-42). β-Amyloid (42-1), menschliches TFA, ist ein 42 AminosÄuren langes Peptid, das eine SchlÜsselrolle in der Pathogenese der Alzheimer-Krankheit spielt. β-Amyloid (42-1), human TFA Chemical Structure
  9. GC37986 β-Amyloid 1-17 β-Amyloid 1-17 ist ein Peptid von β-Amyloid, stabilisiert die Fasern und spielt eine Rolle bei der Aβ-Faserbildung. β-Amyloid 1-17 Chemical Structure
  10. GC37987 β-Amyloid 1-20 β-Amyloid 1-20 besteht aus den Aminosäuren 1 bis 20 des Beta-Amyloid-Proteins. β-Amyloid 1-20 Chemical Structure
  11. GC37993 β-Amyloid 1-9 β-Amyloid 1-9, ein N-terminales Fragment von Beta-Amyloid, besteht aus den Aminosäureresten 1 bis 9. β-Amyloid 1-9 Chemical Structure
  12. GC37985 β-Amyloid 11-22 β-Amyloid 11-22 ist ein Peptidfragment von β-Amyloid. β-Amyloid 11-22 Chemical Structure
  13. GC37988 β-Amyloid 12-20 β-Amyloid 12-20 ist ein Peptidfragment von β-Amyloid. β-Amyloid 12-20 Chemical Structure
  14. GC37991 β-Amyloid 15-21 β-Amyloid 15-21 Chemical Structure
  15. GC37992 β-Amyloid 18-28 β-Amyloid 18-28 ist ein Peptidfragment von β-Amyloid. β-Amyloid 18-28 Chemical Structure
  16. GC37994 β-Amyloid 22-40 β-Amyloid 22-40 ist ein Peptidfragment von β-Amyloid. β-Amyloid 22-40 Chemical Structure
  17. GC37995 β-Amyloid 33-40 β-Amyloid 33-40 ist ein Peptid, das aus den Aminosäuren 33 bis 40 des Beta-Amyloid-Proteins besteht. β-Amyloid 33-40 Chemical Structure
  18. GC37996 β-Amyloid 35-42 β-Amyloid 35-42 ist ein Peptid, das aus den Aminosäuren 35 bis 42 des Beta-Amyloid-Proteins besteht. β-Amyloid 35-42 Chemical Structure
  19. GC37997 β-Amyloid 4-10 β-Amyloid 4-10 ist ein Epitop für den polyklonalen Anti-Aβ(1-42)-Antikörper, reduziert die Amyloidablagerung in einem transgenen Mausmodell der Alzheimer-Krankheit. β-Amyloid 4-10 Chemical Structure
  20. GC34242 β-Amyloid (1-42), rat TFA β-Amyloid (1-42), rat TFA Chemical Structure
  21. GC31146 β-Amyloid (10-35), amide β-Amyloid (10-35), Amid besteht aus 26 Aminosäuren (10-35 Reste des Aβ-Peptids) und ist der Hauptbestandteil der Amyloid-Plaques der Alzheimer-Krankheit. β-Amyloid (10-35), amide Chemical Structure
  22. GC31129 β-Amyloid 1-16 (Amyloid β-Protein (1-16))

    Amyloid β-Protein (1-16)

     β-Amyloid 1-16 (Amyloid β-Protein (1-16)) ist ein &7#946;-Amyloid-Proteinfragment, das an der Metallbindung beteiligt ist. β-Amyloid 1-16 (Amyloid β-Protein (1-16)) Chemical Structure
  23. GC31171 β-Amyloid 1-28 (Amyloid β-Protein (1-28))

    Amyloid β-Protein (1-28)

     β-Amyloid 1-28 (Amyloid β-Protein (1-28)) ist ein &7#946;-Amyloid-Proteinfragment, das an der Metallbindung beteiligt ist. β-Amyloid 1-28 (Amyloid β-Protein (1-28)) Chemical Structure
  24. GC30325 β-Amyloid 22-35 (Amyloid β-Protein (22-35)) β-Amyloid 22-35 (Amyloid β-Protein 22-35), das Fragment der Reste 22-35 von β-Amyloid-Protein, hat eine zytotoxische Wirkung auf kultivierte Neuronen aus dem Hippocampus der Ratte in serumfreiem Medium. β-Amyloid 22-35 (Amyloid β-Protein (22-35)) Chemical Structure
  25. GC31137 β-Amyloid 29-40 (Amyloid beta-protein(29-40)) β-Amyloid 29-40 (Amyloid beta-protein(29-40)) ist ein Fragment von Amyloid-β Peptid. β-Amyloid 29-40 (Amyloid beta-protein(29-40)) Chemical Structure
  26. GC31179 β-Amyloid 31-35 β-Amyloid 31-35 ist die kürzeste Sequenz des nativen Amyloid-β-Peptids, das seine neurotoxische Aktivität behält. β-Amyloid 31-35 Chemical Structure
  27. GC16032 (R,S)-Anatabine

    (±)-Anatabine

     (R,S)-Anatabin ist ein Tabakalkaloid in geringerer Menge, das in der Pflanzenfamilie der NachtschattengewÄchse vorkommt und als spezifischer Marker fÜr den Nachweis von Tabakkonsum verwendet werden kann. (R,S)-Anatabine Chemical Structure
  28. GC16139 (R,S)-Anatabine (tartrate)

    (±)-Anatabine

     Aβ inhibitor (R,S)-Anatabine (tartrate) Chemical Structure
  29. GC30952 4-(6-Bromo-2-benzothiazolyl)-N-methylbenzenamine 4-(6-Brom-2-benzothiazolyl)-N-methylbenzolamin ist ein wirksames Amyloid-Bildgebungsmittel, das an Amyloid-β (1-40) mit einer KD von 1,7 nM bindet. 4-(6-Bromo-2-benzothiazolyl)-N-methylbenzenamine Chemical Structure
  30. GC31208 4-(6-Bromo-2-benzothiazolyl)benzenamine 4-(6-Brom-2-benzothiazolyl)benzenamin ist ein β-Amyloid-PET (Positronen-Emissions-Tomographie)-Tracer, der bei der Diagnose von neurologischen Erkrankungen wie Alzheimer und Down-Syndrom verwendet werden kann. 4-(6-Bromo-2-benzothiazolyl)benzenamine Chemical Structure
  31. GC63502 Aβ/tau aggregation-IN-1 Aβ/tau-Aggregation-IN-1 ist ein potenter Inhibitor der Aβ1-42 β-Faltblattbildung und Tau-Aggregation. Aβ/tau aggregation-IN-1 Chemical Structure
  32. GC68721 Aβ/tau aggregation-IN-3

    Aβ/Tau-Aggregation-IN-3 ist ein wirksamer Inhibitor der Aggregation von Amyloidproteinen, der durch die funktionelle Aggregationsmessung mit Aβ-ThT eine IC50 von 0,85 μM aufweist. Aβ/Tau-Aggregation-IN-3 hat eine Aktivität gegenüber Amyloidproteinen.

     Aβ/tau aggregation-IN-3 Chemical Structure
  33. GC66406 Aducanumab

    BIIB037

    Aducanumab (BIIB037) ist ein humaner monoklonaler Antikörper, der selektiv für aggregierte Formen von Amyloid-Beta (Aβ) ist. Aducanumab zeigt eine Gehirnpenetration und kann für die Alzheimer-Forschung verwendet werden.

     Aducanumab Chemical Structure
  34. GC31259 Aftin-4 Aftin-4 ist ein Induktor von Amyloid-β42 (Aβ42). Aftin-4 Chemical Structure
  35. GC65281 Aleplasinin

    PAZ-417

     Aleplasinin ist ein oral aktiver, potenter, BBB-penetrierter und selektiver SERPINE1 (PAI-1, Plasminogen activator inhibitor-1)-Inhibitor. Aleplasinin Chemical Structure
  36. GC62834 ALZ-801

    ALZ-801

     ALZ-801 ist ein wirksames und oral verfÜgbares niedermolekulares β-Amyloid (A⋲) Anti-Oligomer und Aggregationshemmer, Valin-konjugiertes Prodrug von Tramiprosat mit wesentlich verbesserten PK-Eigenschaften und gastrointestinaler VertrÄglichkeit im Vergleich zur Ausgangssubstanz. ALZ-801 Chemical Structure
  37. GC35334 Amyloid β Peptide (42-1)(human) Amyloid β Peptid (42-1) (Mensch) ist die inaktive Form von Amyloid β Peptid (1-42). Amyloid β Peptide (42-1)(human) Chemical Structure
  38. GA20733 Amyloid β-Protein (1-42)

    Compared to the inner salt, the HCl salt of Aβ42 aggregates more readily at pH 7.4.

     Amyloid β-Protein (1-42) Chemical Structure
  39. GA20736 Amyloid β-Protein (1-43) Amyloid β-Protein (1-43) ist anfÄlliger fÜr Aggregation und hat hÖhere toxische Eigenschaften als das seit langem bekannte A&7#946;1-42. Amyloid β-Protein (1-43) Chemical Structure
  40. GP10099 amyloid A protein fragment [Homo sapiens]

    H2N-Ala-Gly-Leu-Pro-Glu-Lys-Tyr-OH

    Apolipoproteins related to HDL in plasma amyloid A protein fragment [Homo sapiens] Chemical Structure
  41. GP10118 Amyloid Beta-Peptide (1-40) (human)

    Amyloid β-Peptid (1-40) (human), (C194H295N53O58S1), ist ein Peptid mit der Sequenz H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid-Beta (Aβ oder Abeta) ist ein Peptid von 36–43 Aminosäuren, das aus dem Amyloid-Vorläuferprotein verarbeitet wird.

     Amyloid Beta-Peptide (1-40) (human) Chemical Structure
  42. GP10049 Amyloid Beta-Peptide (12-28) (human) Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)). Amyloid Beta-Peptide (12-28) (human) Chemical Structure
  43. GP10082 Amyloid Beta-peptide (25-35) (human)

    Amyloid-Beta-Peptid (25-35) (human) ist ein Fragment des Alzheimer Amyloid-Beta-Peptids, das neurotoxische Effekte hat.

     Amyloid Beta-peptide (25-35) (human) Chemical Structure
  44. GC33160 amyloid P-IN-1 Amyloid P-IN-1 wird zur Erforschung von Krankheiten oder StÖrungen verwendet, bei denen die Serum-Amyloid-P-Komponente (SAP) erschÖpft ist, einschließlich Amyloidose, Alzheimer-Krankheit, Diabetes mellitus Typ 2 und Osteoarthritis. amyloid P-IN-1 Chemical Structure
  45. GP10046 Amyloid Precursor C-Terminal Peptide

    H2N-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH

    For beta amyloid generation

     Amyloid Precursor C-Terminal Peptide Chemical Structure
  46. GP10057 Amyloid β-Peptide (10-20) (human)

    Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe

    Amyloid β-Peptide (10-20) (human) Chemical Structure
  47. GP10094 Amyloid β-peptide (10-35), amide

    H2N-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-NH2

    Amyloid β-peptide (10-35), amide Chemical Structure
  48. GP10097 Amyloid β-Protein (1-15)

    H2N-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-OH

    Amyloid β-Protein (1-15) Chemical Structure
  49. GC39254 Anatabine dicitrate Anatabindicitrat ist ein Tabakalkaloid, das die Blut-Hirn-Schranke passieren kann. Anatabine dicitrate Chemical Structure
  50. GC11309 ARN2966

    2-PMAP

     ARN2966 ist ein potenter posttranskriptioneller Modulator der APP-Expression; reduziert die Expression von APP mit einer daraus resultierenden geringeren Produktion von Aβ. ARN2966 Chemical Structure
  51. GC68714 AZD4694

    NAV4694

    AZD4694 (NAV4694) is a PET radioligand for imaging amyloid-beta (Aβ) plaques in the brain, with high affinity for Aβ fibers (Kd = 2.3 nM).

     AZD4694 Chemical Structure
  52. GC19053 Azeliragon Azeliragon (TTP488) ist ein oral bioverfÜgbarer Inhibitor des Rezeptors fÜr fortgeschrittene Glykationsendprodukte (RAGE), der sich als potenzielle Behandlung zur Verlangsamung des Krankheitsverlaufs bei Patienten mit leichter Alzheimer-Krankheit (AD) in der Entwicklung befindet. Azeliragon Chemical Structure
  53. GC68725 Bapineuzumab

    Bapineuzumab is a monoclonal antibody against β-amyloid protein (APP). Bapineuzumab can be used for research on Alzheimer's disease (AD).

     Bapineuzumab Chemical Structure
  54. GP10083 Beta-Amyloid (1-11)

    H2N-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-OH

    Beta-Amyloid (1-11) Chemical Structure
  55. GC34232 Beta-Amyloid(1-14),mouse,rat Beta-Amyloid(1-14),mouse,rat Chemical Structure
  56. GC31124 BF 227 BF 227 ist ein Kandidat fÜr eine Amyloid-Bildgebungssonde fÜr PET mit einem Ki von 4,3 nM fÜr Aβ1-42-Fibrillen. BF 227 Chemical Structure
  57. GC33750 BF-168 BF-168, eine Kandidatensonde fÜr PET, erkennt spezifisch sowohl neuritische als auch diffuse Plaques mit einem Ki von 6,4 nM fÜr Aβ1-42. BF-168 Chemical Structure
  58. GC15950 CGP 52411

    CGP 52411, 4,5-Dianilinophthalimide

     CGP 52411 (DAPH) ist ein hochselektiver, potenter, oral aktiver und ATP-kompetitiver EGFR-Inhibitor mit einem IC50 von 0,3 μM. CGP 52411 Chemical Structure
  59. GC61887 Cl-NQTrp Cl-NQTrp unterbricht signifikant die vorgeformten fbrillaren Aggregate des von Tau abgeleiteten PHF6 (VQIVYK)-Peptids und des Tau-Proteins in voller LÄnge. Cl-NQTrp Chemical Structure
  60. GC14854 Colivelin Colivelin (CLN) ist ein gehirngängiges neuroprotektives Peptid, das langfristig wirksame Effekte auf die Aβ-Ablagerung, neuronale Apoptose und Defekte der synaptischen Plastizität bei neurodegenerativen Erkrankungen hat. Colivelin Chemical Structure
  61. GC35720 Colivelin TFA Colivelin TFA ist ein in das Gehirn eindringendes neuroprotektives Peptid und ein starker Aktivator von STAT3, der den neuronalen Tod durch Aktivierung von STAT3 in vitro unterdrÜckt. Colivelin TFA Chemical Structure
  62. GC14828 CPHPC

    Ro 63-8695|GSK2315698

     CPHPC ist ein Ligand fÜr die Serum-Amyloid-P-Komponente (SAP) und soll die SAP-Bindung an Amyloidfibrillen und -knÄuel hemmen und dissoziieren. CPHPC Chemical Structure
  63. GC10230 CRANAD 2 CRANAD 2 ist eine Aβ-Plaque-spezifische Fluoreszenzsonde im nahen Infrarot (NIR). CRANAD 2 Chemical Structure
  64. GC12942 DAPT (GSI-IX)

    gamma-Secretase Inhibitor IX, DAPT, GSI-IX

    Inhibitor von γ-Sekretase

     DAPT (GSI-IX) Chemical Structure
  65. GC50733 Davunetide Davunetid ist ein Ausschnitt aus acht AminosÄuren, der vom aktivitÄtsabhÄngigen neuroprotektiven Protein (ADNP) abgeleitet ist, einem neurotrophen Faktor, der im ZNS von SÄugetieren vorkommt. Davunetide Chemical Structure
  66. GC13554 Deferoxamine mesylate

    Ba 33112, DFO, DFOM, DFX, NSC 644468

     Deferoxamine mesylate ist ein Medikament, das Eisen durch die Bildung eines stabilen Komplexes chelatisiert, wodurch das Eisen daran gehindert wird, in weitere chemische Reaktionen einzutreten. Es wird zur Behandlung von chronischer Eisenüberladung bei Patienten mit transfusionsabhängigen Anämien eingesetzt. Deferoxamine mesylate Chemical Structure
  67. GC13256 Dihydroergocristine mesylate Dihydroergocristinmesylat (DHEC-Mesylat) ist ein Inhibitor der γ-Sekretase (GSI), reduziert die Produktion der Amyloid-β-Peptide der Alzheimer-Krankheit, bindet direkt an γ-Sekretase und Nicastrin mit Gleichgewichtsdissoziationskonstanten (Kd) von 25,7 nM und 9,8 μM bzw.. Dihydroergocristine mesylate Chemical Structure
  68. GC68996 Donanemab

    LY3002813

    Donanemab (LY3002813) is a humanized IgG1 monoclonal antibody targeting the N-terminal pyroglutamate of amyloid beta (Aβ) epitope. Donanemab has potential for early Alzheimer's disease research.

     Donanemab Chemical Structure
  69. GC31083 DWK-1339 (MDR-1339)

    MDR-1339

     DWK-1339 (MDR-1339) (DWK-1339) ist ein oral aktiver und Blut-Hirn-Schranke-durchlÄssiger Aβ-Aggregationshemmer, der in der Erforschung der Alzheimer-Krankheit eingesetzt wird. DWK-1339 (MDR-1339) Chemical Structure
  70. GC30823 Edonerpic maleate (T-817 maleate)

    T-187MA

     Edonerpic-Maleat (T-817-Maleat) ist ein neuartiges neurotrophes Mittel, das Amyloid-β hemmen kann; Peptide (Aβ). Edonerpic maleate (T-817 maleate) Chemical Structure
  71. GC10660 EHT 1864 EHT 1864 ist ein Inhibitor der kleinen GTPasen der Rac-Familie. EHT 1864 Chemical Structure
  72. GC10089 EUK 134 EUK 134, ein synthetisches Superoxid-Dismutase- und Katalase-Mimetikum, schützt Rattennieren vor Schäden durch Ischämie-Reperfusion. EUK 134 Chemical Structure
  73. GC62966 Ezeprogind disulfate Ezeprogind disulfate Chemical Structure
  74. GC61476 Fmoc-Ala-Glu-Asn-Lys-NH2 Fmoc-Ala-Glu-Asn-Lys-NH2 ist ein selektives Asparagin-Endopeptidase (AEP)-Inhibitorpeptid und unterdrÜckt die Spaltung des Amyloid-VorlÄuferproteins (APP). Fmoc-Ala-Glu-Asn-Lys-NH2 Chemical Structure
  75. GC15105 FPS-ZM1

    RAGE Antagonist

    Ein WUT-Hemmer

     FPS-ZM1 Chemical Structure
  76. GC36076 Frentizole Frentizol, ein von der FDA zugelassenes Immunsuppressivum, ist ein Aβ-ABAD (bindende Alkoholdehydrogenase)-Interaktionsinhibitor mit einem IC50-Wert von 200 μM. Frentizole Chemical Structure
  77. GC36110 gamma-Secretase Modulators Gamma-Secretase Modulators (Hemmer der Amyloid-β-Produktion) ist ein Inhibitor der Amyloid-β-Produktion. gamma-Secretase Modulators Chemical Structure
  78. GC69150 Gantenerumab

    Gantenerumab is a fully human anti-amyloid-beta (Aβ) IgG1 monoclonal antibody that demonstrates sustained binding to brain amyloid-beta. Gantenerumab can be used for Alzheimer's disease research.

     Gantenerumab Chemical Structure
  79. GN10428 Geniposide Geniposide Chemical Structure
  80. GN10307 Ginsenoside Re

    Chikusetsusaponin IVc, NSC 308877, Panaxoside Re, Sanchinoside Re

     Ginsenoside Re Chemical Structure
  81. GN10544 Ginsenoside Rg1

    Ginsenoside A2, Panaxoside A, Panaxoside Rg1, Sanchinoside C1, Sanchinoside Rg1

     Ginsenoside Rg1, one of the main active components found in Panax ginseng, is a class of natural products known as steroid glycosides with a wide range of biological activities. Ginsenoside Rg1 Chemical Structure
  82. GN10614 Ginsenoside Rg2

    Chikusetsusaponin I, Panaxoside Rg2, Prosapogenin C2

     Ginsenoside Rg2 Chemical Structure
  83. GN10799 Ginsenoside Rg3

    20(S)-Propanaxadiol

     Ginsenoside Rg3 Chemical Structure
  84. GC30892 Glutaminyl Cyclase Inhibitor 1 Glutaminylcyclase-Inhibitor 1 ist ein Glutaminylcyclase-Inhibitor mit einem IC50 von 0,5 μM. Glutaminyl Cyclase Inhibitor 1 Chemical Structure
  85. GC31110 Glutaminyl Cyclase Inhibitor 2 Glutaminylcyclase-Inhibitor 2 ist ein Glutaminylcyclase-Inhibitor mit einem IC50-Wert von 1,23 μM. Glutaminyl Cyclase Inhibitor 2 Chemical Structure
  86. GC36156 Glutaminyl Cyclase Inhibitor 3 Glutaminylcyclase-Inhibitor 3 (Verbindung 212), eine entwickelte Anti-Alzheimer-Verbindung, ist ein potenter humaner Glutaminylcyclase (GC)-Inhibitor mit einem IC50 von 4,5 nM. Glutaminyl Cyclase Inhibitor 3 Chemical Structure
  87. GC17657 Hoechst 34580

    HOE 34580;Proamine;Hoechst-34580;Hoechst34580

    The nucleic acid stain Hoechst 34580 (Ex/Em: 392/440 nm) is frequently utilized as a cell-permeable nuclear counterstain that emits a blue fluorescence upon binding to dsDNA.

     Hoechst 34580 Chemical Structure
  88. GC36247 Hoechst 34580 tetrahydrochloride

    HOE 34580 tetrahydrochloride

     Hoechst 34580 Tetrahydrochlorid ist ein zellgÄngiger Fluoreszenzfarbstoff zur FÄrbung von DNA und Zellkernen. Hoechst 34580 tetrahydrochloride Chemical Structure
  89. GC10988 J 147 J 147 ist ein außergewöhnlich wirksames, oral aktives, neuroprotektives Mittel zur kognitiven Verbesserung. J 147 Chemical Structure
  90. GC30920 K 01-162 (K162)

    K162

     K 01-162 (K162) (K162) hemmt die Fibrillenbildung von Aβ Peptide und beseitigt ihre NeurotoxizitÄt. K 01-162 (K162) Chemical Structure
  91. GC17974 Latrepirdine dihydrochloride

    Dimebon, Latrepirdine

     Latrepirdin ist eine neuroaktive Verbindung mit antagonistischer AktivitÄt an histaminergen, α-adrenergen und serotonergen Rezeptoren. Latrepirdine dihydrochloride Chemical Structure
  92. GC38628 Licochalcone B Licochalcone B Chemical Structure
  93. GC12366 LPYFD-NH2 LPYFD-NH2, ein Pentapeptid, Übt eine gewisse Hemmwirkung auf die Aggregation von Aβ(1-42) aus. LPYFD-NH2 Chemical Structure
  94. GC30884 LX2343 LX2343 ist ein BACE1-Enzyminhibitor mit einem IC50-Wert von 11,43 ± 0,36 μM. LX2343 Chemical Structure
  95. GC10894 Methoxy-X04

    Fluoreszierende Amyloid-β (Aβ)-Sonde

     Methoxy-X04 Chemical Structure
  96. GC31285 MK-3328 MK-3328 ist ein β-Amyloid-PET-Ligand, der mit einer IC50 von 10,5 nM eine hohe BindungsstÄrke aufweist. MK-3328 Chemical Structure
  97. GN10695 Notoginsenoside R1

    Sanchinoside R1

     Notoginsenoside R1 Chemical Structure
  98. GC17037 NQTrp

    1,4-Naphthoquinon-2-yl-L-tryptophan

     NQTrp, ein aromatisches Naphthochinon-Tryptophan-HybridmolekÜl, ein Inhibitor der Aggregation des Tau-Proteins mit generischer anti-amyloidogener Wirkung. NQTrp Chemical Structure
  99. GC68377 OAB-14 OAB-14 Chemical Structure
  100. GC13783 Phenserine

    (-)-Eseroline phenylcarbamate, (-)-N-Phenylcarbamoyleseroline, (-)-Phenserine

     Phenserin ((-)-Eserolinphenylcarbamat) ist ein Derivat von Physostigmin und ist ein potenter, nicht kompetitiver, lang wirkender und selektiver AChE-Hemmer. Phenserine Chemical Structure
  101. GC36954 PQM130 PQM130, ein Feruloyl-Donepezil-Hybrid-Wirkstoff mit Hirnpenetration, ist ein Multitarget-Medikamentenkandidat gegen die durch Aβ1-42-Oligomer (AβO) induzierte NeurotoxizitÄt und zeigt entzÜndungshemmende AktivitÄt. PQM130 Chemical Structure

Artikel 1 bis 100 von 118 gesamt

pro Seite
  1. 1
  2. 2

Absteigend sortieren