Search Site
  • 0
    Mon panier

    Click Here to Find How Many Items You Have Added:)

    image loader

    Adding item(s) to cart......

Accueil >> Peptides

Peptides

Products for  Peptides

  1. Cat.No. Nom du produit Informations
  2. GA24061 Acetyl-(Phe¹)-Octreotide trifluoroacetate salt The peptide is an impurity of octreotide. Acetyl-(Phe¹)-Octreotide trifluoroacetate salt Chemical Structure
  3. GA20526 Acetyl-(Pro¹⁸,Asp²¹)-Amyloid β-Protein (17-21) amide The pentapeptide Ac-LPFFD-NH? (iAβ5p) is an analog of product H-4876 with small chemical modifications which enhance its stability against proteolytic degradation. iAβ5p acts as a β-sheet breaker peptide and crosses the blood-brain barrier at a higher rate than most proteins and peptides known to be selectively taken up by the brain so that it is assumed that the peptide is being specifically transported to the brain. A significant increase in neuronal survival and decrease in brain inflammation associated with the reduction of amyloid plaques in two different transgenic Alzheimer`s disease (AD) models is additionally reported for iAβ5p. Acetyl-(Pro¹⁸,Asp²¹)-Amyloid β-Protein (17-21) amide Chemical Structure
  4. GA20535 Acetyl-Amyloid β-Protein (1-6) amide Experiments using sub-peptides of Aβ42 revealed that the epitope identified by the antibody A8, as described by Ying and coworkers, lies within the 1-6 region of Aβ. The antibody displays high affinity for soluble Aβ42 oligomers in the molecular weight range of 16.5-25 kDa, and detected target antigen in brain sections from senescence-accelerated SAMP 8 mice. Amidated or acetylated and amidated forms of the sequence were used for example for quantitative structure retention relationships (QSRR) experiments. The latter could allow prediction of reversed-phase high-performance liquid chromatography (HPLC) retention of peptides, as reported by Kaliszan and coworkers. Acetyl-Amyloid β-Protein (1-6) amide Chemical Structure
  5. GA20534 Acetyl-Amyloid β-Protein (15-20) amide Incubation of Ac-QKLVFF-NH? with the amyloid β-protein (1-40) inhibited polymerization of the amyloid β-protein (1-40) into amyloid fibrils. The peptide is thought to block the polymerization sites. Acetyl-Amyloid β-Protein (15-20) amide Chemical Structure
  6. GA20533 Acetyl-Amyloid β/A4 Protein Precursor₇₇₀ (96-110) (cyclized) This cyclized peptide which is homologous to the heparin-binding domain of APP, binds strongly to heparin and inhibits binding of ¹²?I-labeled APP to heparin (IC??= 10??M). The peptide blocks the heparan sulfate proteoglycan-dependent stimulatory effect of APP on neurite outgrowth. Acetyl-Amyloid β/A4 Protein Precursor₇₇₀ (96-110) (cyclized) Chemical Structure
  7. GC12152 Acetyl-Calpastatin (184-210) (human) Acetyl-Calpastatin (184-210) (human) Chemical Structure
  8. GA20540 Acetyl-Hirudin (54-65) (sulfated) L'acétyl-hirudine (54-65) (sulfatée) se lie directement À la thrombine-rHCII (L444R) et perturbe les interactions entre le domaine acide N-terminal du rHCII et l'exosite I de liaison aux anions de la thrombine qui sert À stabiliser le complexe . Acetyl-Hirudin (54-65) (sulfated) Chemical Structure
  9. GA24062 Acetyl-Octreotide Potential impurity of octreotide. Acetyl-Octreotide Chemical Structure
  10. GA20545 Acetyl-Pepstatin L'acétyl-pepstatine est un puissant inhibiteur classique des protéases aspartiques (PR) avec des valeurs XMRV PR et HIV-1 PR Ki de 712 nM et 13 nM . Acetyl-Pepstatin Chemical Structure
  11. GA24063 Acetyl-PHF6 amide The sequence VQIVYK within the third repeat of tau is essential for fibrillization. Acetyl-PHF6 amide Chemical Structure
  12. GC34387 Acetyl-PHF6 amide TFA

    AcPHF6 TFA; Ac-VQIVYK-NH2 TFA

     L'acétyl-PHF6 amide TFA (AcPHF6 TFA) est un hexapeptide dérivé de tau. Acetyl-PHF6 amide TFA Chemical Structure
  13. GC74410 AChRα(97-116) AChRα(97-116), un peptide, peut être utilisé pour induire la myasthénie gravis expérimentale auto-immune EAMG. AChRα(97-116) Chemical Structure
  14. GC42713 ACTH (1-10) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)

    Adrenocorticotropic Hormone (1-10), Corticotropin (1-10)

     Adrenocorticotropic hormone (ACTH) (1-10) is an N-terminal peptide fragment of ACTH, a peptide hormone produced by the anterior pituitary gland that is involved in the biological stress response. ACTH (1-10) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) Chemical Structure
  15. GC45372 ACTH (1-13) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)

    SYSMEHFRWGKPV-OH

       ACTH (1-13) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) Chemical Structure
  16. GC35243 ACTH (1-14) TFA

    Adrenocorticotropic Hormone Fragment 1-14 TFA

     ACTH (1-14) TFA Chemical Structure
  17. GC45373 ACTH (1-16) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)

    Adrenocorticotropic Hormone (1-16), SYSMEHFRWGKPVGKK-OH

       ACTH (1-16) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) Chemical Structure
  18. GC45374 ACTH (1-17) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)

    Adrenocorticotropic Hormone (1-17), SYSMEHFRWGKPVGKKR-OH

       ACTH (1-17) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) Chemical Structure
  19. GC35244 ACTH (1-17) TFA

    α1-17-ACTH TFA

     ACTH (1-17) TFA Chemical Structure
  20. GC12239 ACTH (1-39) L'ACTH (1-39) est un agoniste des récepteurs de la mélanocortine. ACTH (1-39) Chemical Structure
  21. GC45375 ACTH (1-39) (trifluoroacetate salt)

    Adrenocorticotropic Hormone (1-39)

       ACTH (1-39) (trifluoroacetate salt) Chemical Structure
  22. GC65350 ACTH (34-39) L'ACTH (34-39) est un fragment d'hormone corticotrope. ACTH (34-39) Chemical Structure
  23. GC40161 ACTH (4-10) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)

    Adrenocorticotropic Hormone (4-10), Corticotropin (4-10)

     Adrenocorticotropic hormone (ACTH) (4-10) is an endogenous peptide fragment of ACTH, a peptide hormone produced by the anterior pituitary gland that is involved in the biological stress response. ACTH (4-10) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) Chemical Structure
  24. GC40132 ACTH (6-24) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)

    HFRWGKPVGKKRRPVKVYP

     ACTH (6-24) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response. ACTH (6-24) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) Chemical Structure
  25. GC31925 ACTH 1-13 (Adrenocorticotropic Hormone (1-13))

    Adrenocorticotropic Hormone (1-13)

     L'ACTH 1-13 (hormone adrénocorticotrope (1-13)) est un peptide 13-aa, avec des effets cytoprotecteurs dans le modèle de lésions gastriques induites par l'éthanol chez le rat. ACTH 1-13 (Adrenocorticotropic Hormone (1-13)) Chemical Structure
  26. GC30547 ACTH 1-14 (Adrenocorticotropic Hormone Fragment 1-14) L'ACTH 1-14 (Adrenocorticotropic Hormone Fragment 1-14) est un fragment de l'adrénocorticotrophine, qui régule la production de cortisol et d'androgènes. ACTH 1-14 (Adrenocorticotropic Hormone Fragment 1-14) Chemical Structure
  27. GC31109 ACTH 1-17 (α1-17-ACTH)

    α1-17-ACTH

     L'ACTH 1-17 (α1-17-ACTH), un analogue de l'adrénocorticotropine, est un puissant agoniste des récepteurs de la mélanocortine 1 humaine (MC1) avec un Ki de 0,21 nM. ACTH 1-17 (α1-17-ACTH) Chemical Structure
  28. GC31954 ACTH 11-24 (Adrenocorticotropic Hormone (11-24)) L'ACTH 11-24 (hormone adrénocorticotrope (11-24)) est un antagoniste des récepteurs de l'hormone adrénocorticotrope (ACTH). ACTH 11-24 (Adrenocorticotropic Hormone (11-24)) Chemical Structure
  29. GC31507 ACTH 22-39 (Adrenocorticotropic Hormone (22-39))

    Adrenocorticotropic Hormone (22-39)

     L'ACTH 22-39 (hormone adrénocorticotrope (22-39)) est un fragment de l'hormone adrénocorticotrope (ACTH). ACTH 22-39 (Adrenocorticotropic Hormone (22-39)) Chemical Structure
  30. GC31530 ACTH 4-11 (Adrenocorticotropic Hormone (4-11), human)

    MEHFRWGK-OH

     L'ACTH 4-11 (hormone adrénocorticotrope (4-11), humaine), un fragment d'hormone adrénocorticotrope, possède une faible puissance d'hormone de stimulation des mélanocytes (α-MSH) uniquement À des doses élevées (100 et 1000 nM). ACTH 4-11 (Adrenocorticotropic Hormone (4-11), human) Chemical Structure
  31. GC35245 Activated Protein C (390-404), human La protéine C activée (390-404), humaine est un peptide de la protéine C activée (une protéase À sérine dépendante de la vitamine K), inhibe puissamment l'activité anticoagulante de l'APC. Activated Protein C (390-404), human Chemical Structure
  32. GC35246 Activated Protein C (390-404), human TFA La protéine C activée (390-404), le TFA humain, un peptide de la protéine C activée (une sérine protéase dépendante de la vitamine K), inhibe puissamment l'activité anticoagulante de l'APC. Activated Protein C (390-404), human TFA Chemical Structure
  33. GC74360 ACV Tripeptide TFA ACV Tripeptide TFA est la forme TFA du Tripeptide ACV. ACV Tripeptide TFA Chemical Structure
  34. GC68622 Acyl Carrier Protein (ACP) (65-74)

    Acyl Carrier Protein (ACP) (65-74) est un fragment actif de la protéine porteuse d'acyl ACP.

     Acyl Carrier Protein (ACP) (65-74) Chemical Structure
  35. GC31528 Adipokinetic Hormone (AKH) (24-32), locust L'hormone adipocinétique (AKH) (24-32), du criquet, isolée des corps cardiaques du criquet, est une neurohormone qui régule l'utilisation des lipides pendant le vol. Adipokinetic Hormone (AKH) (24-32), locust Chemical Structure
  36. GC33774 Adrenocorticotropic Hormone (ACTH) (1-10), human L'hormone adrénocorticotrope (ACTH) (1-10), humaine, un fragment d'hormone adrénocorticotrope, possède une faible puissance d'hormone de stimulation des mélanocytes α (α-MSH) uniquement À des doses élevées (100 et 1000 nM). Adrenocorticotropic Hormone (ACTH) (1-10), human Chemical Structure
  37. GC35253 Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA)

    1-39-Corticotropin (human)(TFA)

     L'hormone adrénocorticotrope (ACTH) (1-39), humaine (TFA) est un agoniste des récepteurs de la mélanocortine. Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) Chemical Structure
  38. GC35254 Adrenocorticotropic Hormone (ACTH) (1-39), rat

    ACTH (1-39) (mouse, rat)

     Hormone adrénocorticotrope (ACTH) (1-39), le rat est un puissant agoniste des récepteurs de la mélanocortine 2 (MC2). Adrenocorticotropic Hormone (ACTH) (1-39), rat Chemical Structure
  39. GC33788 Adrenocorticotropic Hormone (ACTH) (18-39), human (CLIP (human))

    Adrenocorticotropic Hormone (18-39), Corticotropin-like Intermediate Lobe Peptide, RPVKVYPNGAEDESAEAFPLEF

     L'hormone adrénocorticotrope (ACTH) (18-39), humaine (CLIP (humain)) est un peptide du lobe intermédiaire de type corticotropine, qui est produit dans les mélanotrophes du lobe intermédiaire de l'hypophyse. Adrenocorticotropic Hormone (ACTH) (18-39), human (CLIP (human)) Chemical Structure
  40. GC65059 Adrenocorticotropic Hormone (ACTH) (18-39), human TFA

    CLIP (human) (TFA)

     Hormone adrénocorticotrope (ACTH) (18-39), le TFA humain est un peptide du lobe intermédiaire de type corticotropine, qui est produit dans les mélanotrophes du lobe intermédiaire de l'hypophyse. Adrenocorticotropic Hormone (ACTH) (18-39), human TFA Chemical Structure
  41. GC33790 Adrenocorticotropic Hormone (ACTH) (4-10), human L'hormone adrénocorticotrope (ACTH) (4-10), humaine est un agoniste des récepteurs de la mélanocortine 4 (MC4R). Adrenocorticotropic Hormone (ACTH) (4-10), human Chemical Structure
  42. GC42737 Adrenomedullin (1-12) (human) (trifluoroacetate salt) Adrenomedullin (1-12) is an N-terminal fragment of adrenomedullin (1-52). Adrenomedullin (1-12) (human) (trifluoroacetate salt) Chemical Structure
  43. GC42739 Adrenomedullin (1-50) amide (rat) (trifluoroacetate salt) Adrenomedullin (1-50) is a peptide hormone with RNA expressed in rat adrenal glands, lung, kidney, heart, and spleen, as well as in the duodenum and submandibular glands. Adrenomedullin (1-50) amide (rat) (trifluoroacetate salt) Chemical Structure
  44. GC34230 Adrenomedullin (1-50), rat L'adrénomédulline (1-50) de rat est un peptide de 50 acides aminés, qui induit une vasodilatation artérielle sélective via l'activation du récepteur CGRP1. Adrenomedullin (1-50), rat Chemical Structure
  45. GC42740 Adrenomedullin (1-52) (human) (trifluoroacetate salt)

    Adrenomedullin (1-52)-NH2

     Adrenomedullin (1-52) is a peptide with diverse biological activities. Adrenomedullin (1-52) (human) (trifluoroacetate salt) Chemical Structure
  46. GC46807 Adrenomedullin (1-52) (porcine) (trifluoroacetate salt)

    YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 (Cys16 and 21 bridge)

     A neuropeptide with diverse biological activities Adrenomedullin (1-52) (porcine) (trifluoroacetate salt) Chemical Structure
  47. GC40158 Adrenomedullin (11-50) (rat) (trifluoroacetate salt) Adrenomedullin (11-50) is a truncated form of rat adrenomedullin. Adrenomedullin (11-50) (rat) (trifluoroacetate salt) Chemical Structure
  48. GC35256 Adrenomedullin (11-50), rat L'adrénomédulline (11-50), rat est le fragment C-terminal (11-50) de l'adrénomédulline de rat. Adrenomedullin (11-50), rat Chemical Structure
  49. GC42738 Adrenomedullin (13-52) (human) (trifluoroacetate salt) Adrenomedullin (13-52) is a truncated form of adrenomedullin (1-52). Adrenomedullin (13-52) (human) (trifluoroacetate salt) Chemical Structure
  50. GC42741 Adrenomedullin (22-52) (human) (trifluoroacetate salt) Adrenomedullin (22-52) is a C-terminal fragment of adrenomedullin (1-52). Adrenomedullin (22-52) (human) (trifluoroacetate salt) Chemical Structure
  51. GC33955 Adrenomedullin (AM) (1-52), human

    Human adrenomedullin-(1-52)-NH2

     L'adrénomédulline (AM) (1-52), humaine est un peptide de 52 acides aminés, qui affecte la prolifération cellulaire et l'angiogenèse dans le cancer. Adrenomedullin (AM) (1-52), human Chemical Structure
  52. GC32622 Adrenomedullin (AM) (13-52), human L'adrénomédulline (AM) (13-52), humaine est un peptide de 40 acides aminés, qui agit comme un agent vasodilatateur dépendant de l'endothélium. Adrenomedullin (AM) (13-52), human Chemical Structure
  53. GC32615 Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin (human)) L'adrénomédulline (AM) (22-52), humaine (22-52-adrénomédulline (humaine)), un analogue tronqué de l'adrénomédulline NH2 terminal, est un antagoniste des récepteurs de l'adrénomédulline et antagonise également le récepteur du peptide lié au gène de la calcitonine (CGRP) dans le membre postérieur vasculaire lit du chat. Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin (human)) Chemical Structure
  54. GC11039 AF 12198 L'AF 12198 est un antagoniste peptidique puissant, sélectif et spécifique du récepteur humain de l'interleukine-1 de type I (IL1-R1) (IC50 \u003d 8 nM) mais pas du récepteur humain de type II (IC50 \u003d 6,7 µM) ni du récepteur murin de type I ( IC50 \u003e 200 µM). AF 12198 Chemical Structure
  55. GC35264 AGA-(C8R) HNG17, Humanin derivative AGA-(C8R) HNG17, le dérivé d'humanine est un puissant dérivé d'humanine (HN). AGA-(C8R) HNG17, Humanin derivative Chemical Structure
  56. GC61526 AGA-(C8R) HNG17, humanin derivative TFA AGA-(C8R) HNG17, dérivé d'humanine Le TFA est un puissant dérivé d'humanine (HN). AGA-(C8R) HNG17, humanin derivative TFA Chemical Structure
  57. GC14867 Agitoxin 2 L'agitoxine 2 est un inhibiteur du canal K+, avec des valeurs IC50 de 201 pM et 144 pM pour mKV1.3 et mKV1.1, respectivement). Agitoxin 2 Chemical Structure
  58. GC15822 Akt/SKG Substrate Peptide Akt/SKG Substrate Peptide est un peptide synthétique approprié comme substrat pour Akt/PKB, qui n'est pas phosphorylé par p70S6K ou MAPK1. Akt/SKG Substrate Peptide Chemical Structure
  59. GC90508 Ala-D-γ-Glu-Lys-D-Ala-D-Ala (trifluoroacetate salt)

    Un pentapeptide de peptidoglycane

     Ala-D-γ-Glu-Lys-D-Ala-D-Ala (trifluoroacetate salt) Chemical Structure
  60. GC74327 Ala-MPSD TFA Ala-MPSD TFA est un peptide de contrôle pour MPSD. Ala-MPSD TFA Chemical Structure
  61. GC35282 Alexamorelin Met 1 Alexamorelin Met 1 Chemical Structure
  62. GC68636 Alirinetide

    GM604

    Alirinetide (GM604) is a peptide containing 6 amino acids. Alirinetide can cross the blood-brain barrier and can be used in research for various neurodegenerative diseases.

     Alirinetide Chemical Structure
  63. GC19584 Alkaline Phosphatase La phosphatase alcaline est une glycoprotéine liée À la membrane qui catalyse l'hydrolyse des monoesters de phosphate À des valeurs de pH basiques. Alkaline Phosphatase Chemical Structure
  64. GC35291 Allatostatin II L'allatostatine II est un décapeptide. Allatostatin II Chemical Structure
  65. GC35292 Allatostatin IV L'allatostatine IV est un octapeptide. Allatostatin IV Chemical Structure
  66. GC30940 Allergen Gal d 4 (46-61), chicken (Lysozyme C (46-61) (chicken))

    Lysozyme C (46-61) (chicken)

     Allergène Gal d 4 (46-61), poulet (Lysozyme C (46-61) (poulet)) est un peptide de lysozyme de blanc d'œuf de poule. Allergen Gal d 4 (46-61), chicken (Lysozyme C (46-61) (chicken)) Chemical Structure
  67. GC74408 Alloferon 1 Alloferon 1 est un peptide antiviral et antitumoral. Alloferon 1 Chemical Structure
  68. GC35304 Alpha 1(I) Collagen (614-639), human Alpha 1(I) Collagen (614-639), humain est un fragment peptidique de collagène alpha-1 de type I. Alpha 1(I) Collagen (614-639), human Chemical Structure
  69. GC32208 ALX 40-4C ALX 40-4C est un petit inhibiteur peptidique du récepteur de chimiokine CXCR4, empêche SDF-1 de se lier À CXCR4 avec un Ki de 1 μM et supprime la réplication des souches X4 du VIH-1; Le trifluoroacétate d'ALX 40-4C agit également comme antagoniste du récepteur APJ, avec une IC50 de 2,9 μM. ALX 40-4C Chemical Structure
  70. GC34386 ALX 40-4C Trifluoroacetate Le trifluoroacétate d'ALX 40-4C est un petit inhibiteur peptidique du récepteur de chimiokine CXCR4, empêche SDF-1 de se lier À CXCR4 avec un Ki de 1 μM et supprime la réplication des souches X4 du VIH-1; Le trifluoroacétate d'ALX 40-4C agit également comme antagoniste du récepteur APJ, avec une IC50 de 2,9 μM. ALX 40-4C Trifluoroacetate Chemical Structure
  71. GC49262 Alytesin (trifluoroacetate salt) A neuropeptide with diverse biological activities Alytesin (trifluoroacetate salt) Chemical Structure
  72. GC30514 AMARA peptide Le peptide AMARA est un substrat pour SIK et AMPK. AMARA peptide Chemical Structure
  73. GC34224 AMARA peptide TFA Le peptide AMARA (TFA) est un substrat pour la kinase inductible par le sel (SIK) et la protéine kinase activée par l'adénosine monophosphate (AMPK). AMARA peptide TFA Chemical Structure
  74. GC16513 Amylin L'amyline, un polypeptide de 37 acides aminés, est une hormone pancréatique cosécrétée avec l'insuline qui exerce des rÔles uniques dans le métabolisme et l'homéostasie du glucose. Amylin Chemical Structure
  75. GC42793 Amylin (1-13) (human, mouse, rat), (trifluoroacetate salt)

    IAPP (1-13) (human, mouse rat), Islet Amyloid Polypeptide (1-13) (human. mouse, rat)

     Amylin (1-13) is a peptide fragment of amylin , which is a peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety. Amylin (1-13) (human, mouse, rat), (trifluoroacetate salt) Chemical Structure
  76. GA20710 Amylin (8-37) (human) Human IAPP (8-37), ATQRLANFLVHSSNNFGAILSSTNVGSNTY-amide, readily forms fibrils in vitro. Amylin (8-37) (human) Chemical Structure
  77. GC42794 Amylin (8-37) (human) (trifluoroacetate salt)

    IAPP (8-37) (human), Islet Amyloid Polypeptide (8-37) (human)

     Amylin (8-37) is a peptide fragment of amylin. Amylin (8-37) (human) (trifluoroacetate salt) Chemical Structure
  78. GC35331 Amylin (8-37), rat

    Amylin (8-37) (mouse, rat)

     L'amyline (8-37), rat est un analogue tronqué de l'amyline native qui inhibe sélectivement l'absorption de glucose liée À l'insuline et le dépÔt de glycogène dans les tissus musculaires. Amylin (8-37), rat Chemical Structure
  79. GA24066 Amylin (free acid) (human)

    IAPP (free acid) (human)

     Amylin (free acid) (human) Chemical Structure
  80. GC42795 Amylin (human) (amidated) (trifluoroacetate salt)

    IAPP (human) (amidated), Islet Amyloid Polypeptide (human) (amidated)

     Amylin is a peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety. Amylin (human) (amidated) (trifluoroacetate salt) Chemical Structure
  81. GC42796 Amylin (human) (trifluoroacetate salt)

    IAPP (human), Islet Amyloid Polypeptide (human)

     Amylin is a 37-residue peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety. Amylin (human) (trifluoroacetate salt) Chemical Structure
  82. GC35332 Amylin (IAPP), feline L'amyline (IAPP), féline est un polypeptide de 37 acides aminés de félin. Amylin (IAPP), feline Chemical Structure
  83. GC60581 Amylin (IAPP), feline TFA Amyline (IAPP), le TFA félin est un polypeptide de 37 acides aminés félin. Amylin (IAPP), feline TFA Chemical Structure
  84. GC42797 Amylin (rat, mouse) (trifluoroacetate salt)

    IAPP (rat, mouse), Islet Amyloid Polypeptide (rat, mouse)

     Amylin is a 37-residue peptide hormone secreted by pancreatic β-cells that reduces food intake, modifies glycogen synthesis, slows gastric emptying, and increases satiety. Amylin (rat, mouse) (trifluoroacetate salt) Chemical Structure
  85. GC35333 Amylin, amide, rat

    Amylin (rat)

     Amylin, amide, rat est un ligand puissant et de haute affinité des récepteurs Amylin AMY1 et AMY3 et de manière variable des récepteurs AMY2; des études de liaison sont généralement utilisées pour ce dernier récepteur. Amylin, amide, rat Chemical Structure
  86. GC35334 Amyloid β Peptide (42-1)(human) AmyloÏde β Le peptide (42-1) (humain) est la forme inactive de l'amyloÏde β ; Peptide (1-42). Amyloid β Peptide (42-1)(human) Chemical Structure
  87. GC35335 Amyloid β-peptide (1-40) rat L'amyloÏde β-peptide (1-40) rat est une forme de rat de l'amyloÏde β-peptide, qui s'accumule sous forme de dépÔt extracellulaire insoluble autour des neurones, donnant naissance aux plaques séniles associées À la maladie d'Alzheimer (MA). Amyloid β-peptide (1-40) rat Chemical Structure
  88. GA20721 Amyloid β-Protein (1-12) Amyloid β-Protein (1-12) Chemical Structure
  89. GA20722 Amyloid β-Protein (1-14) The N-terminal Aβ fragments Aβ1-14, Aβ1-15 (H-6368), and Aβ1-16 (H-2958) are elevated in cell media and in CSF in response to γ-secretase inhibitor treatment. The presence of these small peptides is consistent with a catabolic amyloid precursor protein cleavage pathway by β- followed by α-secretase. It has been shown that Aβ1-14, Aβ1-15, and Aβ1-16 increase dose-dependently in response to γ-secretase inhibitor treatment while Aβ1-42 levels are unchanged. Amyloid β-Protein (1-14) Chemical Structure
  90. GA20724 Amyloid β-Protein (1-24) Amyloid β-Protein (1-24) Chemical Structure
  91. GA20725 Amyloid β-Protein (1-37) La protéine amyloÏde β-protéine (1-37) est modérément corrélée aux scores du mini-examen de l'état mental (MMSE) dans la maladie d'Alzheimer. Amyloid β-Protein (1-37) Chemical Structure
  92. GA20726 Amyloid β-Protein (1-38) Like Aβ (25-35) (H-1192), the Aβ fragment (1-38) destabilizes calcium homeostasis and renders human cortical neurones vulnerable to environmental insults. Amyloid β-Protein (1-38) Chemical Structure
  93. GA20727 Amyloid β-Protein (1-39) Small quantities of Aβ37, 38 and 39 can be detected in CSF together with Aβ40, the most abundant Aβ homolog, Aβ42, and N-terminally truncated amyloid peptides. The relative amounts depend on the variant of Alzheimer's disease. The C-terminally truncated amyloid peptides are also found in amyloid plaques. Amyloid β-Protein (1-39) Chemical Structure
  94. GA20728 Amyloid β-Protein (1-40) (scrambled) Amyloid β-Protein (1-40) (scrambled) Chemical Structure
  95. GA20729 Amyloid β-Protein (1-40) amide Amyloid β-Protein (1-40) amide Chemical Structure
  96. GA24067 Amyloid β-Protein (1-40)-Lys(biotinyl) amide

    Abeta (1-40) Lys (Biotin) amide

     For immobilization of Aβ40. Amyloid β-Protein (1-40)-Lys(biotinyl) amide Chemical Structure
  97. GA20733 Amyloid β-Protein (1-42)

    Compared to the inner salt, the HCl salt of Aβ42 aggregates more readily at pH 7.4.

     Amyloid β-Protein (1-42) Chemical Structure
  98. GA20731 Amyloid β-Protein (1-42) (scrambled) Amyloid β-Protein (1-42) (scrambled) Chemical Structure
  99. GA24068 Amyloid β-Protein (1-42)-Lys(biotinyl) amide

    Beta-Amyloid (1-42)-Lys(biotin) amide

     For immobilization of Aβ42. Amyloid β-Protein (1-42)-Lys(biotinyl) amide Chemical Structure
  100. GA20736 Amyloid β-Protein (1-43) L'amyloÏde β-La protéine (1-43) est plus sujette À l'agrégation et a des propriétés toxiques plus élevées que l'Aβ1-42. Amyloid β-Protein (1-43) Chemical Structure
  101. GA20737 Amyloid β-Protein (1-46) Precursor of the secreted amyloid β-protein (1-40) and (1-42). The identification of amyloid-β-protein (1-46) led to the identification of a zeta-cleavage site between the known γ- and ε-cleavage sites within the transmembrane domain of amyloid-β precursor protein (APP). Amyloid β-Protein (1-46) Chemical Structure

Articles 401 à 500 sur un total de 2391

par page
  2. 3
  3. 4
  4. 5
  5. 6
  6. 7

Par ordre décroissant