Search Site
  • 0
    Mon panier

    Click Here to Find How Many Items You Have Added:)

    image loader

    Adding item(s) to cart......

Accueil >> Signaling Pathways >> Neuroscience >> Neuroendocrinology

Neuroendocrinology

Products for  Neuroendocrinology

  1. Cat.No. Nom du produit Informations
  2. GC41699 (Des-octanoyl)-Ghrelin (human) (trifluoroacetate salt) Ghrelin is an endogenous gastrointestinal hormone and neuropeptide that binds to the growth hormone (GH) secretagogue receptor (GHS-R). (Des-octanoyl)-Ghrelin (human) (trifluoroacetate salt) Chemical Structure
  3. GC42294 3-Iodothyronamine (hydrochloride)

    T1AM

     3-Iodothyronamine is derived from the deiodination and decarboxylation of endogenous thyroxine. 3-Iodothyronamine (hydrochloride) Chemical Structure
  4. GC52172 5-hydroxy Indole-3-acetic Acid-d6

    5-HIAA-d6, 5-Hydroxyindoleacetic Acid-d6, 5-hydroxy IAA-d6

     5-hydroxy Indole-3-acetic Acid-d6 Chemical Structure
  5. GC40132 ACTH (6-24) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)

    HFRWGKPVGKKRRPVKVYP

     ACTH (6-24) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response. ACTH (6-24) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) Chemical Structure
  6. GC46807 Adrenomedullin (1-52) (porcine) (trifluoroacetate salt)

    YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 (Cys16 and 21 bridge)

     A neuropeptide with diverse biological activities Adrenomedullin (1-52) (porcine) (trifluoroacetate salt) Chemical Structure
  7. GC42741 Adrenomedullin (22-52) (human) (trifluoroacetate salt) Adrenomedullin (22-52) is a C-terminal fragment of adrenomedullin (1-52). Adrenomedullin (22-52) (human) (trifluoroacetate salt) Chemical Structure
  8. GC42794 Amylin (8-37) (human) (trifluoroacetate salt)

    IAPP (8-37) (human), Islet Amyloid Polypeptide (8-37) (human)

     Amylin (8-37) is a peptide fragment of amylin. Amylin (8-37) (human) (trifluoroacetate salt) Chemical Structure
  9. GC42795 Amylin (human) (amidated) (trifluoroacetate salt)

    IAPP (human) (amidated), Islet Amyloid Polypeptide (human) (amidated)

     Amylin is a peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety. Amylin (human) (amidated) (trifluoroacetate salt) Chemical Structure
  10. GC42796 Amylin (human) (trifluoroacetate salt)

    IAPP (human), Islet Amyloid Polypeptide (human)

     Amylin is a 37-residue peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety. Amylin (human) (trifluoroacetate salt) Chemical Structure
  11. GC42852 Arginine Vasotocin (trifluoroacetate salt)

    Arg8-Vasotocin, AVT

     Arginine vasotocin is a nonapeptide hormone agonist of the AVT receptor (EC50 = 13 nM for eliciting membrane currents in X. Arginine Vasotocin (trifluoroacetate salt) Chemical Structure
  12. GC42918 Benzomalvin C Benzomalvin C is a weak antagonist of the neurokinin-1 (NK1) receptor inhibiting binding of substance P by 46% when used at 100 μg/ml in vitro. Benzomalvin C Chemical Structure
  13. GC46941 Bombesin (trifluoroacetate salt)

    Glp-Gln-Arg-LeuGly-Asn-GlnTrp-Ala-ValGly-His-LeuMet-NH2

     A neuropeptide with diverse biological activities Bombesin (trifluoroacetate salt) Chemical Structure
  14. GC43113 Caerulein (acetate)

    Ceruletide

     Caerulein is an oligopeptide originally isolated from skin extracts of H. Caerulein (acetate) Chemical Structure
  15. GC43215 CCK Octapeptide (non-sulfated), (trifluoroacetate salt)

    Cholecystokinin Octapeptide (26-33), Pancreozymin (C-terminal) Octapeptide, SQ 19,265

     Cholecystokinin (CCK) octapeptide is a peptide hormone found in the intestine and brain that stimulates digestion, mediates satiety, and is involved in anxiety. CCK Octapeptide (non-sulfated), (trifluoroacetate salt) Chemical Structure
  16. GC47097 CJC-1295

    Modified GRF (1-29), CJC-1295-no DAC, GHRH (1-29)-NH2

     A synthetic peptide derivative of GHRH CJC-1295 Chemical Structure
  17. GC92120 CJC-1295 (acetate)

    Modified GRF (1-29); CJC-1295-no DAC; GHRH (1-29)-NH2

     CJC-1295 (acetate) est un dérivé peptidique synthétique de l'hormone de libération de l'hormone de croissance (GHRH). CJC-1295 (acetate) Chemical Structure
  18. GC45724 Corticosterone-d8

    17-deoxy Cortisol-d8, 11β,21-DHP-d8, 11β,21-dihydroxy Progesterone-d8

     An internal standard for the quantification of corticosterone Corticosterone-d8 Chemical Structure
  19. GC43311 Cortistatin-14 (trifluoroacetate salt)

    Cortistatin-14 is an endogenous neuropeptide agonist of somatostatin receptors (IC50s = 0.5-18.2 nM for human SST1-SST5 receptors expressed in CCL39 cells).

     Cortistatin-14 (trifluoroacetate salt) Chemical Structure
  20. GC43338 Cyclic ADP-Ribose (ammonium salt)

    cADP-Ribose；cADPR

     Cyclic ADP-ribose (cADP-ribose) is an endogenous metabolite of NAD+ that mobilizes the release of stored Ca2+ in the endoplasmic reticulum via ryanodine receptors in various cell types. Cyclic ADP-Ribose (ammonium salt) Chemical Structure
  21. GC47262 Domperidone-d6 An internal standard for the quantification of domperidone Domperidone-d6 Chemical Structure
  22. GC43582 Dynorphin B (1-9) (trifluoroacetate salt) Dynorphin B (1-9) is a neuropeptide and N-terminal cleavage product of dynorphin B, an endogenous opioid. Dynorphin B (1-9) (trifluoroacetate salt) Chemical Structure
  23. GC45448 Epitalon (acetate)

    Epithalone

       Epitalon (acetate) Chemical Structure
  24. GC43724 Galanin (rat, mouse) (trifluoroacetate salt)

    GAL (rat, mouse)

    Galanin is a neuropeptide with diverse biological activities.

     Galanin (rat, mouse) (trifluoroacetate salt) Chemical Structure
  25. GC43752 Ghrelin (rat) (acetyl) (trifluoroacetate salt) Ghrelin is an endogenous gastrointestinal hormone and neuropeptide that binds to the growth hormone (GH) secretagogue receptor (GHS-R). Ghrelin (rat) (acetyl) (trifluoroacetate salt) Chemical Structure
  26. GC43753 Ghrelin (rat) (palmitoyl) (trifluoroacetate salt) Ghrelin is an endogenous gastrointestinal hormone and neuropeptide that binds to the growth hormone (GH) secretagogue receptor (GHS-R). Ghrelin (rat) (palmitoyl) (trifluoroacetate salt) Chemical Structure
  27. GC45803 GHRP-2 (trifluoroacetate salt)

    D-Ala-3-(2-naphthalenyl)-D-Ala-L-Ala-L-Trp-D-Phe-L-lysinamide, Growth Hormone-Releasing Peptide 2, KP-102, Pralmorelin

     A neuropeptide with diverse biological activities GHRP-2 (trifluoroacetate salt) Chemical Structure
  28. GC45459 GHRP-6 (acetate)

    Growth Hormone Releasing Peptide 6, Hexapeptide-2, HWAWFK-NH2, SKF 110679, U 75799E

       GHRP-6 (acetate) Chemical Structure
  29. GC92133 Glucose-dependent Insulinotropic Polypeptide (1-42) (porcine) (trifluoroacetate salt)

    Gastric Inhibitory Peptide (1-42); GIP (1-42)

     Glucose-dependent Insulinotropic Polypeptide (1-42) (porcine) (trifluoroacetate salt) est une hormone entéro - insulinotrope peptidique de 42 acides aminés endogènes qui induit la sécrétion d'insuline. Glucose-dependent Insulinotropic Polypeptide (1-42) (porcine) (trifluoroacetate salt) Chemical Structure
  30. GC43781 GnRH (free acid; trifluoroacetate salt)

    Gonadorelin, Gonadotropin-releasing Hormone, LHRH

     Gonadotropin releasing hormone (GnRH) is a peptide hormone produced in the hypothalamus that is secreted in a pulsatile fashion and stimulates the release of luteinizing hormone and follicle-stimulating hormone. GnRH (free acid; trifluoroacetate salt) Chemical Structure
  31. GC43782 GnRH II (trifluoroacetate salt)

    Gonadotropin-releasing Hormone II, LHRH II

     Gonadotropin-releasing hormone II (GnRH II) is a peptide agonist of the GnRH receptor (GnRHR). GnRH II (trifluoroacetate salt) Chemical Structure
  32. GC91946 HexylHIBO (hydrobromide)

    Hexylhomoibotenic Acid

     HexylHIBO (hydrobromide) est un antagoniste des récepteurs métabotropes du groupe I au glutamate (mGluRs; Kbs = 140 et 110 μM pour mGluR1α et mGluR5a, respectivement). HexylHIBO (hydrobromide) Chemical Structure
  33. GC92098 HS-024 (trifluoroacetate salt)

    Ac-Cys-Nle-Arg-His-D-Nal-Arg-Trp-Gly-Cys-NH2; cyclic [AcCys3,Nle4,Arg5,D-Nal7,Cys-NH211]α-MSH-(3-11)

     HS-024 (trifluoroacetate salt) est un antagoniste cyclopeptidique du récepteur 4 de la mélanocortine (mc4r; ki = 0,29 nm). HS-024 (trifluoroacetate salt) Chemical Structure
  34. GC91449 Ipamorelin (acetate)

    Aib-His-D-2-Nal-D-Phe-Lys-NH2; NNC 26-0161

    Ipamorelin est un agoniste du récepteur GHS 1a (GHS-R1a) et un sécrétagogue d'hormone de croissance pentapeptide (GHS).

     Ipamorelin (acetate) Chemical Structure
  35. GC44137 MCH (human, mouse, rat) (trifluoroacetate salt)

    Melanin-Concentrating Hormone

     Melanin-concentrating hormone (MCH) is an endogenous hypothalamic neuropeptide hormone that is an agonist at MCH receptors. MCH (human, mouse, rat) (trifluoroacetate salt) Chemical Structure
  36. GC92129 Melanostatin (frog, eel) (trifluoroacetate salt)

    Neuropeptide Y; NPY

     Melanostatin (frog, eel) (trifluoroacetate salt) est un peptide endogène. Melanostatin (frog, eel) (trifluoroacetate salt) Chemical Structure
  37. GC44168 Metanephrine

    DL-Metanephrine

    Metanephrine is a metabolite of epinephrine produced by the action of catechol-O-methyl transferase on epinephrine.

     Metanephrine Chemical Structure
  38. GC49423 Metanephrine-d3 (hydrochloride)

    DL-Metanephrine-d3

     An internal standard for the quantification of metanephrine Metanephrine-d3 (hydrochloride) Chemical Structure
  39. GC44374 Neuromedin B (trifluoroacetate salt)

    NMB

     Neuromedin B (NMB) is a peptide agonist of the NMB receptor (Ki = 7.4 nM in NCI-H1299 small cell lung cancer cells expressing the human receptor). Neuromedin B (trifluoroacetate salt) Chemical Structure
  40. GC44378 Neuromedin S (rat) (trifluoroacetate salt)

    NMS

     Neuromedin S is a neuropeptide agonist of the neuromedin U (NMU) receptors that increases calcium concentrations in CHO cells overexpressing NMU1 and NMU2 (EC50s = 65 and 91 pM, respectively). Neuromedin S (rat) (trifluoroacetate salt) Chemical Structure
  41. GC92100 Neuropeptide EI (rat) (trifluoroacetate salt)

    NEI; Neuropeptide-Glutamic Acid-Isoleucine

     Neuropeptide EI (rat) (trifluoroacetate salt) est un fragment peptidique endogène de MCH, une hormone de pré - mélanine concentrée chez le rat impliquée dans la libération d'hormones, le comportement de peignage et l'activité motrice. Neuropeptide EI (rat) (trifluoroacetate salt) Chemical Structure
  42. GC47769 Neuropeptide S (human) (acetate)

    NPS

     A neuropeptide NSPR agonist Neuropeptide S (human) (acetate) Chemical Structure
  43. GC19802 Octreotide acetate

    Octreotide

    Octreotide is a somatostatin analogue, which can bind to somatostatin receptor. It mainly has 2, 3 and 5 subtypes, which can enhance GI activity and reduce intracellular cAMP production

     Octreotide acetate Chemical Structure
  44. GC52453 Orexin A (17-33) (human, mouse, rat, bovine) (trifluoroacetate salt)

    OXA (17-33)

     A peptide orexin receptor 1 agonist Orexin A (17-33) (human, mouse, rat, bovine) (trifluoroacetate salt) Chemical Structure
  45. GC52507 Orexin A amide (bovine, human, mouse, rat) (trifluoroacetate salt)

    Hypocretin 1, OXA

     A hypothalamic neuropeptide Orexin A amide (bovine, human, mouse, rat) (trifluoroacetate salt) Chemical Structure
  46. GC44512 Orexin B (human) (trifluoroacetate salt) Orexin B is a hypothalamic neuropeptide that regulates feeding behavior, wakefulness, and behavior under situations of high motivational relevance. Orexin B (human) (trifluoroacetate salt) Chemical Structure
  47. GC49553 Orexin B amide (human) (trifluoroacetate salt)

    Hypocretin 2, OXB

     A hypothalamic neuropeptide Orexin B amide (human) (trifluoroacetate salt) Chemical Structure
  48. GC44525 Oxyntomodulin (human, mouse, rat) (trifluoroacetate salt)

    Glicentin (33-69), Proglucagon (33-69)

     Oxyntomodulin is a peptide hormone involved in regulation of food intake, energy expenditure, and glucose metabolism. Oxyntomodulin (human, mouse, rat) (trifluoroacetate salt) Chemical Structure
  49. GC52502 Peptide YY (3-36) (trifluoroacetate salt)

    Pancreatic Peptide YY, Peptide Tyrosine Tyrosine

     A satiety hormone Peptide YY (3-36) (trifluoroacetate salt) Chemical Structure
  50. GC44598 Peptide YY (human) (trifluoroacetate salt)

    Peptide Tyrosine Tyrosine

    Peptide YY (PYY) is a 36-amino acid peptide and anorectic gut hormone agonist for the neuropeptide Y receptors Y1, Y2, Y5, and Y6 with EC50 values of 0.7, 0.58, 1, and 0.8 nM, respectively, for supression of forskolin-induced cAMP accumulation.

     Peptide YY (human) (trifluoroacetate salt) Chemical Structure
  51. GC49108 Racecadotril-d5

    Acetorphan-d5

     An internal standard for the quantification of racecadotril Racecadotril-d5 Chemical Structure
  52. GC90638 S1H (trifluoroacetate salt)

    Un antagoniste peptidique synthétique du récepteur de l'hormone de croissance.

     S1H (trifluoroacetate salt) Chemical Structure
  53. GC49679 Sauvagine (trifluoroacetate salt) A neuropeptide hormone Sauvagine (trifluoroacetate salt) Chemical Structure
  54. GC44881 Secretin (human) (trifluoroacetate salt) Secretin is an endogenous 27-amino acid gastrointestinal hormone and neuropeptide that regulates secretion from the stomach, pancreas, and liver. Secretin (human) (trifluoroacetate salt) Chemical Structure
  55. GC48327 Secretin (rat) (trifluoroacetate salt) A neuropeptide hormone Secretin (rat) (trifluoroacetate salt) Chemical Structure
  56. GC49592 Sermorelin (acetate)

    Growth Hormone-releasing Factor (1-29) amide, hGH-RH(1-29)-NH2, hGRF(1-29)NH2, hpGRF(1-29)NH2, Somatotropin Releasing-Hormone (1-29) amide

     A growth hormone-releasing hormone analog Sermorelin (acetate) Chemical Structure
  57. GC49123 Somatorelin (1-44) amide (human) (trifluoroacetate salt)

    Growth Hormone-releasing Factor (1-44) amide, hpGRF-44, Human Pancreas GRF-44, Somatoliberin

     A synthetic GHRH peptide Somatorelin (1-44) amide (human) (trifluoroacetate salt) Chemical Structure
  58. GC44914 Somatostatin-14 (acetate) Somatostatin-14 is a natural cyclic peptide hormone derived from the preprohormone, somatostatin. Somatostatin-14 (acetate) Chemical Structure
  59. GC49574 Somatostatin-28 (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) A cyclic neuropeptide hormone Somatostatin-28 (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) Chemical Structure
  60. GC52390 Spexin 1 (human, mouse, rat, bovine) (acetate)

    Neuropeptide Q, NPQ, NWTPQAMLYLKGAQ-NH2, SPX1

     An endogenous peptide and agonist of GAL2 and GAL3 Spexin 1 (human, mouse, rat, bovine) (acetate) Chemical Structure
  61. GC48174 Thiorphan-d5 An internal standard for the quantification of thiorphan Thiorphan-d5 Chemical Structure
  62. GC45588 Urocortin II (mouse) (trifluoroacetate salt)   Urocortin II (mouse) (trifluoroacetate salt) Chemical Structure
  63. GC45589 Urocortin III (human) (trifluoroacetate salt)   Urocortin III (human) (trifluoroacetate salt) Chemical Structure
  64. GC45592 Urotensin I (white sucker) (trifluoroacetate salt)   Urotensin I (white sucker) (trifluoroacetate salt) Chemical Structure
  65. GC52414 [Ala17]-MCH (trifluoroacetate salt)

    Ala17-Melanin-Concentrating Hormone

     An MCH-derived peptide and MCH receptor agonist [Ala17]-MCH (trifluoroacetate salt) Chemical Structure

64 article(s)

par page

Par ordre décroissant