Neuroscience Peptides
Neuroscience
Neurons communicate with each other, effector organs and sensory organs through the neurotransmitter – receptor pathway at synapses. Neurotransmitters can be divided into 4 major groups: 1. Amino acids (glumate, aspartate, serine, glycine and GABA); 2. Monoamines (norepinephrine, epinephrine, dopamine, histamine, and serotonin); 3. Peptides (opioid peptides, substance P, somatostatin); and 4. Others (acetylcholine, NO, nucleosides). read more
Products for Neuroscience Peptides
- Cat.No. Nom du produit Informations
- GP10121 Ac-Endothelin-1 (16-21), human
- GP10109 Adrenorphin
- GP10102 Adrenorphin, Free Acid
- GP10076 Agouti-related Protein (AGRP) (25-82), human
- GP10099 amyloid A protein fragment [Homo sapiens] Apolipoproteins related to HDL in plasma
-
GP10118
Amyloid Beta-Peptide (1-40) (human)
Peptide Amyloid β (1-40) (humain), (C194H295N53O58S1), un peptide avec la séquence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. L'amyloïde bêta (Aβ ou Abeta) est un peptide de 36 à 43 acides aminés qui est produit à partir de la protéine précurseur d'amyloïde.
-
GP10049
Amyloid Beta-Peptide (12-28) (human)
Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)).
-
GP10082
Amyloid Beta-peptide (25-35) (human)
Le peptide bêta-amyloïde (25-35) (humain) est un fragment du peptide bêta-amyloïde de la maladie d'Alzheimer qui a des effets neurotoxiques.
-
GP10046
Amyloid Precursor C-Terminal Peptide
For beta amyloid generation
- GP10057 Amyloid β-Peptide (10-20) (human)
- GP10094 Amyloid β-peptide (10-35), amide
- GP10097 Amyloid β-Protein (1-15)
- GP10083 Beta-Amyloid (1-11)
-
GP10051
Beta-Lipotropin (1-10), porcine
Morphine-like substance
- GP10101 Beta-Sheet Breaker Peptide iAβ5
-
GP10127
Cadherin Peptide, avian
Role in cell adhesion
- GP10010 COG 133
- GP10126 Diazepam-Binding Inhibitor Fragment, human Diazepam-Binding Inhibitor (DBI) Fragment is encoded by the DBI gene in human.
- GP10070 Dynorphin (2-17), amide, porcine
- GP10065 Endomorphin-1
- GP10146 ferritin heavy chain fragment [Multiple species]
- GP10107 Gap 26
-
GP10119
Gap 27
A connexin-mimetic peptide
- GP10115 GTP-Binding Protein Fragment, G alpha
- GP10041 Insulin like growth factor II fragment variant Insulin like growth factor II fragment variant has a sequence of Thr-Pro-Thr-Lys-Ser-Glu-Arg.
- GC14612 JNJ-31020028 JNJ-31020028 est un antagoniste sélectif et pénétrant dans le cerveau du récepteur neuropeptide Y Y2 avec des valeurs de pIC50 de 8,07 et 8,22 pour le récepteur Y2 humain et de rat, respectivement.
-
GP10103
Laminin (925-933)
Laminine (925-933) (CDPGYIGSR), est la séquence de Laminine sur la chaîne B1.
- GP10066 Melanocyte stimulating hormone release inhibiting factor
- GP10006 Myelin Basic Protein (68-82), guinea pig
-
GP10130
Myelin Basic Protein (87-99)
An encephalitogenic peptide
- GP10011 Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell
- GP10069 Parathyroid hormone (1-34) (human)
- GP10106 Parathyroid Hormone (1-34), bovine
-
GP10014
parathyroid hormone (7-34) [Homo sapiens]/[Macaca fascicularis]
Enhancer of blood calcium level
-
GP10032
Rac GTPase fragment
Fragment of small signaling G proteins
- GP10042 Rhodopsin peptide
- GP10084 type II collagen fragment
-
GP10017
[Ser25] Protein Kinase C (19-31)
PKC substrate
- GP10081 α-Endorphin
- GP10111 β-Pompilidotoxin