Accueil >> Signaling Pathways >> Neuroscience >> Neuroscience Peptides

Neuroscience Peptides

Neuroscience

Neurons communicate with each other, effector organs and sensory organs through the neurotransmitter – receptor pathway at synapses. Neurotransmitters can be divided into 4 major groups: 1. Amino acids (glumate, aspartate, serine, glycine and GABA); 2. Monoamines (norepinephrine, epinephrine, dopamine, histamine, and serotonin); 3. Peptides (opioid peptides, substance P, somatostatin); and 4. Others (acetylcholine, NO, nucleosides). read more

Products for  Neuroscience Peptides

  1. Cat.No. Nom du produit Informations
  2. GP10121 Ac-Endothelin-1 (16-21), human

    Ac-His-Leu-Asp-Ile-Ile-Trp-OH

    Ac-Endothelin-1 (16-21), human  Chemical Structure
  3. GP10109 Adrenorphin

    H2N-Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-amide

    Adrenorphin  Chemical Structure
  4. GP10102 Adrenorphin, Free Acid

    Adrenorphin, Free Acid,H2N-Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-OH

    Adrenorphin, Free Acid  Chemical Structure
  5. GP10076 Agouti-related Protein (AGRP) (25-82), human

    H2N-Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu-Lys-Lys-Thr-Thr-Ala-Glu-Gln-Ala-Glu-Glu-Asp-Leu-Leu-Gln-Glu-Ala-Gln-Ala-Leu-Ala-Glu-Val-Leu-Asp-Leu-Gln-Asp-Arg-Glu-Pro-Arg-OH

    Agouti-related Protein (AGRP) (25-82), human  Chemical Structure
  6. GP10099 amyloid A protein fragment [Homo sapiens]

    H2N-Ala-Gly-Leu-Pro-Glu-Lys-Tyr-OH

    Apolipoproteins related to HDL in plasma amyloid A protein fragment [Homo sapiens]  Chemical Structure
  7. GP10118 Amyloid Beta-Peptide (1-40) (human)

    Peptide Amyloid β (1-40) (humain), (C194H295N53O58S1), un peptide avec la séquence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. L'amyloïde bêta (Aβ ou Abeta) est un peptide de 36 à 43 acides aminés qui est produit à partir de la protéine précurseur d'amyloïde.

    Amyloid Beta-Peptide (1-40) (human)  Chemical Structure
  8. GP10049 Amyloid Beta-Peptide (12-28) (human) Amyloid Beta-Peptide (12-28) (human) est un fragment peptidique de la protéine amyloïde bêta (1-42) (Aβ (1-42)). Amyloid Beta-Peptide (12-28) (human)  Chemical Structure
  9. GP10082 Amyloid Beta-peptide (25-35) (human) Amyloid Beta-peptide (25-35) (human) est un fragment du peptide bêta-amyloïde d'Alzheimer que l'on trouve généralement dans le cerveau des personnes atteintes de la maladie d'Alzheimer (MA) et qui est un composant majeur des plaques amyloïdes d'Alzheimer. Amyloid Beta-peptide (25-35) (human)  Chemical Structure
  10. GP10046 Amyloid Precursor C-Terminal Peptide

    H2N-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH

    For beta amyloid generation

    Amyloid Precursor C-Terminal Peptide  Chemical Structure
  11. GP10057 Amyloid β-Peptide (10-20) (human)

    Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe

    Amyloid β-Peptide (10-20) (human)  Chemical Structure
  12. GP10094 Amyloid β-peptide (10-35), amide

    H2N-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-NH2

    Amyloid β-peptide (10-35), amide  Chemical Structure
  13. GP10097 Amyloid β-Protein (1-15)

    H2N-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-OH

    Amyloid β-Protein (1-15)  Chemical Structure
  14. GP10083 Beta-Amyloid (1-11)

    H2N-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-OH

    Beta-Amyloid (1-11)  Chemical Structure
  15. GP10051 Beta-Lipotropin (1-10), porcine

    H2N-Glu-Leu-Ala-Gly-Ala-Pro-Pro-Glu-Pro-Ala-OH

    Morphine-like substance

    Beta-Lipotropin (1-10), porcine  Chemical Structure
  16. GP10101 Beta-Sheet Breaker Peptide iAβ5

    H2N-Leu-Pro-Phe-Phe-Asp-OH

    Beta-Sheet Breaker Peptide iAβ5  Chemical Structure
  17. GP10127 Cadherin Peptide, avian

    H2N-Leu-Arg-Ala-His-Ala-Val-Asp-Val-Asn-Gly-amide

    Role in cell adhesion

    Cadherin Peptide, avian  Chemical Structure
  18. GP10010 COG 133

    Leu-Arg-Val-Arg-Leu-Ala-Ser-His-Leu-Arg-Lys-Leu-Arg-Lys-Arg-Leu-Leu

    COG 133  Chemical Structure
  19. GP10126 Diazepam-Binding Inhibitor Fragment, human

    H2N-Gln-Ala-Thr-Val-Gly-Asp-Ile-Asn-Thr-Glu-Arg-Pro-Gly-Met-Leu-Asp-Phe-Thr-Gly-Lys-OH

    Diazepam-Binding Inhibitor (DBI) Fragment is encoded by the DBI gene in human. Diazepam-Binding Inhibitor Fragment, human  Chemical Structure
  20. GP10070 Dynorphin (2-17), amide, porcine

    H2N-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-amide

    Dynorphin (2-17), amide, porcine  Chemical Structure
  21. GP10065 Endomorphin-1 Endomorphin-1  Chemical Structure
  22. GP10146 ferritin heavy chain fragment [Multiple species]

    H2N-Tyr-Leu-Asn-Glu-Gln-Val-Lys-Ala-Ile-OH

    ferritin heavy chain fragment [Multiple species]  Chemical Structure
  23. GP10107 Gap 26

    Val-Cys-Tyr-Asp-Lys-Ser-Phe-Pro-Ile-Ser-His-Val-Arg

    Gap 26, as a connexin mimetic peptide, which has the SHVR amino acid regions contributing crucially to the docking of connexons to generate gap junctions. Gap 26  Chemical Structure
  24. GP10119 Gap 27

    Ser-Arg-Pro-Thr-Glu-Lys-Thr-Ile-Phe-Ile-Ile

    A connexin-mimetic peptide

    Gap 27  Chemical Structure
  25. GP10115 GTP-Binding Protein Fragment, G alpha

    H2N-Cys-Gly-Ala-Gly-Glu-Ser-Gly-Lys-Ser-Thr-Ile-Val-Lys-Gln-Met-Lys-OH

    GTP-Binding Protein Fragment, G alpha  Chemical Structure
  26. GP10041 Insulin like growth factor II fragment variant

    H2N-Thr-Pro-Thr-Lys-Ser-Glu-Arg-OH

    Insulin like growth factor II fragment variant has a sequence of Thr-Pro-Thr-Lys-Ser-Glu-Arg. Insulin like growth factor II fragment variant  Chemical Structure
  27. GC14612 JNJ-31020028 JNJ-31020028 est un antagoniste sélectif et pénétrant dans le cerveau du récepteur neuropeptide Y Y2 avec des valeurs de pIC50 de 8,07 et 8,22 pour le récepteur Y2 humain et de rat, respectivement. JNJ-31020028  Chemical Structure
  28. GP10103 Laminin (925-933)

    CDPGYIGSR, Cys-Asp-Pro-Gly-Tyr-Ile-Gly-Ser-Arg

    Laminin (925-933)(CDPGYIGSR), est la séquence de la Laminine sur la chaîne B1. Laminin (925-933)  Chemical Structure
  29. GP10066 Melanocyte stimulating hormone release inhibiting factor

    Pro-Leu-Gly

    Melanocyte stimulating hormone release inhibiting factor  Chemical Structure
  30. GP10006 Myelin Basic Protein (68-82), guinea pig Myelin Basic Protein (68-82), guinea pig  Chemical Structure
  31. GP10130 Myelin Basic Protein (87-99)

    Val-His-Phe-Phe-Lys-Asn-Ile-Val-Thr-Pro-Arg-Thr-Pro

    An encephalitogenic peptide

    Myelin Basic Protein (87-99)  Chemical Structure
  32. GP10011 Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell

    Ac-Pro-Tyr-Asn-Ser-Ser-Pro-Arg-Pro-Glu-Gln-His-Lys-Ser-Tyr-Lys-Cys-OH

    Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell  Chemical Structure
  33. GP10069 Parathyroid hormone (1-34) (human)

    Teriparatide Acetate; Human parathyroid hormone-(1-34); hPTH (1-34)

    Parathyroid hormone (1-34) (human) est le fragment N-terminal (34 acides aminés) de human Parathyroid hormone (PTH) et est un agoniste du récepteur de Parathyroid hormone 1 (PTH1). Parathyroid hormone (1-34) (human)  Chemical Structure
  34. GP10106 Parathyroid Hormone (1-34), bovine Parathyroid Hormone (1-34), bovine  Chemical Structure
  35. GP10014 parathyroid hormone (7-34) [Homo sapiens]/[Macaca fascicularis]

    H2N-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH

    Enhancer of blood calcium level

    parathyroid hormone (7-34) [Homo sapiens]/[Macaca fascicularis]  Chemical Structure
  36. GP10032 Rac GTPase fragment

    H2N-Val-Phe-Asp-Glu-Ala-Ile-Arg-Ala-Val-OH

    Fragment of small signaling G proteins

    Rac GTPase fragment  Chemical Structure
  37. GP10042 Rhodopsin peptide

    H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH

    Rhodopsin peptide  Chemical Structure
  38. GP10084 type II collagen fragment

    H2N-Gly-Glu-Pro-Gly-Ile-Ala-Gly-Phe-Lys-Gly-Glu-Gln-Gly-Pro-Lys-OH

    type II collagen fragment  Chemical Structure
  39. GP10017 [Ser25] Protein Kinase C (19-31)

    H2N-Arg-Phe-Ala-Arg-Lys-Gly-Ser-Leu-Arg-Gln-Lys-Asn-Val-OH

    PKC substrate

    [Ser25] Protein Kinase C (19-31)  Chemical Structure
  40. GP10081 α-Endorphin α-Endorphin  Chemical Structure
  41. GP10111 β-Pompilidotoxin

    Arg-Ile-Lys-Ile-Gly-Leu-Phe-Asp-Gln-Leu-Ser-Arg-Leu

    β-Pompilidotoxin  Chemical Structure

40 article(s)

par page

Par ordre décroissant