Amyloid Beta-Peptide (1-40) (human) |
Catalog No.GP10118 |
인간 Amyloid β-Peptide (1-40) (C194H295N53O58S1)은 H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH 시퀀스를 가진 펩타이드로, 분자량은 4329.8입니다. 아밀로이드 베타(Aβ 또는 Abeta)는 아밀로이드 전구 단백질에서 처리된 36~43개의 아미노산으로 이루어진 펩타이드입니다.
Products are for research use only. Not for human use. We do not sell to patients.
Cas No.: 131438-79-4
Sample solution is provided at 25 µL, 10mM.
Quality Control & SDS
- View current batch:
- Purity: >98.00%
- COA (Certificate Of Analysis)
- SDS (Safety Data Sheet)
- Datasheet
Cell experiment: [1] | |
Cell lines |
CA1 pyramidal cells |
Preparation method |
The solubility of this peptide in sterile water is >10 mM. Stock solution should be splited and stored at -80°C for several months. |
Reaction Conditions |
200 nM, 20 min |
Applications |
Aβ (1–40) reversibly increased IBa evoked at +20 mV. This increase was observed for 6 of 11 cells and reached 1.74±0.06. The activation curve showed that Aβ (1–40) caused an apparent voltage-dependent increase in IBa, with an enhancement of IBa at the test potentials between 0 and +30 mV. |
Animal experiment: [2] | |
Animal models |
Male Charles River Wistar rats |
Dosage form |
Intraperitoneal injection, 400 mg/kg |
Applications |
A statistically significant decrease in basal ACh release (-30%) was detected one week after the injection of Aβ (1-40). 30 days after the Aβ (1-40) peptide injection, the decrease in Ach release was still statistically significant (-38%). K+-stimulated ACh release was similarly affected by the treatment. Aβ (1–40) treatment induced a significant decrease in the stimulated release on day 14 after lesioning (-43%). |
Other notes |
Please test the solubility of all compounds indoor, and the actual solubility may slightly differ with the theoretical value. This is caused by an experimental system error and it is normal. |
References: [1] Rovira C, Arbez N, Mariani J. Aβ (25–35) and Aβ (1–40) act on different calcium channels in CA1 hippocampal neurons. Biochemical and biophysical research communications, 2002, 296(5): 1317-1321. [2] Giovannelli L, Casamenti F, Scali C, et al. Differential effects of amyloid peptides β-(1–40) and β-(25–35) injections into the rat nucleus basalis. Neuroscience, 1995, 66(4): 781-792. |
인간 Amyloid β-Peptide (1-40) (C194H295N53O58S1), 시퀀스 H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8의 펩타이드입니다. Amyloid beta(Aβ 또는 Abeta)는 Amyloid 전구 단백질에서 처리된 36~43 아미노산으로 이루어진 펩타이드입니다. Alzheimer병과 관련된 amyloid plaques의 구성 요소로 가장 잘 알려져 있지만, Aβ가 중요한 비병리적 활동을 갖는 매우 다기능성 있는 펩타이드임이 밝혀졌습니다[1]. Aβ는 Alzheimer병 환자의 뇌에서 발견되는 침착물의 주요 성분입니다. sporadic Alzheimer's disease환자들은 뇌 내 Aβ가 증가합니다. Aβ는 뇌 조직 및 혈관 아밀로이드의 주요 성분으로서, 뇌혈관 병변에 기여하며 신경 독성을 나타냅니다[2]. Aβ 단백질은 β와 γ 시크레터아제에 의해 연속적으로 생성됩니다. C-말단 부분을 생산하는 γ 시크레터아제는 APP(transmembrane region 내부에서 절단)를 분해하고 36-43 아미노산 잔여물의 여러 isoform을 생성할 수 있습니다. 가장 일반적인 isoform은 Aβ40과 Aβ42입니다. 더 긴 형태는 endoplasmic reticulum에서 발생하는 절단으로 생산되며, 더 짧은 형태는 trans-Golgi network 내에서 절단으로 생산됩니다[3].
References:
1. Lahiri DK, Maloney B (September 2010). "Beyond the signaling effect role of amyloid–β42 on the processing of AβPP, and its clinical implications". Exp. Neurol. 225 (1): 51–4.
2. Hardy J, Duff K, Hardy KG, Perez-Tur J, Hutton M (September 1998). "Genetic dissection of Alzheimer's disease and related dementias: amyloid and its relationship to tau". Nat. Neurosci. 1 (5): 355–8.
3. Hartmann T, Bieger SC, Brühl B, Tienari PJ, Ida N, Allsop D, Roberts GW, Masters CL, Dotti CG, Unsicker K, Beyreuther K (September 1997). "Distinct sites of intracellular production for Alzheimer's disease A beta40/42 amyloid peptides". Nat. Med. 3 (9): 1016–20.
Cas No. | 131438-79-4 | SDF | |
Formula | C194H295N53O58S | M.Wt | 4329.86 |
Solubility | ≥43.28mg/mL in DMSO | Storage | Desiccate at -20°C |
General tips | Please select the appropriate solvent to prepare the stock solution according to the
solubility of the product in different solvents; once the solution is prepared, please store it in
separate packages to avoid product failure caused by repeated freezing and thawing.Storage method
and period of the stock solution: When stored at -80°C, please use it within 6 months; when stored
at -20°C, please use it within 1 month. To increase solubility, heat the tube to 37°C and then oscillate in an ultrasonic bath for some time. |
||
Shipping Condition | Evaluation sample solution: shipped with blue ice. All other sizes available: with RT, or with Blue Ice upon request. |
Prepare stock solution | |||
1 mg | 5 mg | 10 mg | |
1 mM | 0.231 mL | 1.1548 mL | 2.3095 mL |
5 mM | 0.0462 mL | 0.231 mL | 0.4619 mL |
10 mM | 0.0231 mL | 0.1155 mL | 0.231 mL |
Step 1: Enter information below (Recommended: An additional animal making an allowance for loss during the experiment)
Step 2: Enter the in vivo formulation (This is only the calculator, not formulation. Please contact us first if there is no in vivo formulation at the solubility Section.)
Calculation results:
Working concentration: mg/ml;
Method for preparing DMSO master liquid: mg drug pre-dissolved in μL DMSO ( Master liquid concentration mg/mL, Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug. )
Method for preparing in vivo formulation: Take μL DMSO master liquid, next addμL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O, mix and clarify.
Method for preparing in vivo formulation: Take μL DMSO master liquid, next add μL Corn oil, mix and clarify.
Note: 1. Please make sure the liquid is clear before adding the next solvent.
2. Be sure to add the solvent(s) in order. You must ensure that the solution obtained, in the previous addition, is a clear solution before proceeding to add the next solvent. Physical methods such as vortex, ultrasound or hot water bath can be used to aid dissolving.
3. All of the above co-solvents are available for purchase on the GlpBio website.
Average Rating: 5
(Based on Reviews and 30 reference(s) in Google Scholar.)GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *