- Cat.No. 상품명 정보
-
GC44598
Peptide YY (human) (trifluoroacetate salt)
Peptide YY (PYY) is a 36-amino acid peptide and anorectic gut hormone agonist for the neuropeptide Y receptors Y1, Y2, Y5, and Y6 with EC50 values of 0.7, 0.58, 1, and 0.8 nM, respectively, for supression of forskolin-induced cAMP accumulation.
- GC31767 Peptide 401 봉독의 강력한 비만세포 탈과립 인자인 펩티드 401은 다양한 평활근 경련제(히스타민, 5-HT)의 피내 주사로 인해 증가된 혈관 투과성을 억제합니다.
- GC52502 Peptide YY (3-36) (trifluoroacetate salt) A satiety hormone
-
GP10118
Amyloid Beta-Peptide (1-40) (human)
인간 Amyloid β-Peptide (1-40) (C194H295N53O58S1)은 H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH 시퀀스를 가진 펩타이드로, 분자량은 4329.8입니다. 아밀로이드 베타(Aβ 또는 Abeta)는 아밀로이드 전구 단백질에서 처리된 36~43개의 아미노산으로 이루어진 펩타이드입니다.
-
GP10049
Amyloid Beta-Peptide (12-28) (human)
Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)).
-
GP10082
Amyloid Beta-peptide (25-35) (human)
알츠하이머 아밀로이드 베타 펩타이드의 단편인 인간 Amyloid beta-peptide (25-35)은 신경독성 효과가 있습니다.
- GC52385 Myelin Basic Protein (85-99) Peptide Antagonist (trifluoroacetate salt) An MBP (85-99) antagonist
- GP10011 Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell
- GP10094 Amyloid β-peptide (10-35), amide
- GP10042 Rhodopsin peptide
-
GP10127
Cadherin Peptide, avian
Role in cell adhesion
-
GP10046
Amyloid Precursor C-Terminal Peptide
For beta amyloid generation
- GP10057 Amyloid β-Peptide (10-20) (human)
- GC34396 Calcitonin Gene Related Peptide (CGRP) (83-119), rat
- GC34395 Calcitonin Gene Related Peptide (CGRP) (83-119), rat TFA
- GC52476 Bax Inhibitor Peptide V5 (trifluoroacetate salt) A Bax inhibitor
- GP10101 Beta-Sheet Breaker Peptide iAβ5
- GC42803 Amyloid-β (25-35) Peptide (human) (trifluoroacetate salt) Amyloid-β (25-35) (Aβ (25-35)) is an 11-residue fragment of the Aβ protein that retains the physical and biological characteristics of the full length peptide.
- GC46851 Amyloid-β (1-42) Peptide (trifluoroacetate salt) A 42-amino acid protein fragment of amyloid-β
- GC35432 Autocamtide-2-related inhibitory peptide (TFA)
- GC62702 RAGE antagonist peptide TFA RAGE 길항제 펩티드 TFA는 고급 당화 최종 생성물(RAGE) 길항제입니다.
- GC61593 DAPK Substrate Peptide TFA DAPK 기질 펩타이드 TFA는 9μM의 Km을 갖는 DAPK(death associated protein kinase)용 합성 펩타이드 기질입니다.
- GC44987 TAMRA-Amyloid-β (1-42) Peptide (trifluoroacetate salt) TAMRA-Amyloid-β (1-42) peptide is a fluorescently labeled peptide.
- GC42937 Biotin-Amyloid-β (1-42) Peptide (trifluoroacetate salt) Biotin-amyloid-β (1-42) peptide is an affinity probe that allows amyloid-β (1-42) (Aβ42) to be detected or immobilized through interaction with the biotin ligand.
- GC42801 Amyloid-β (1-8) Peptide Amyloid-β (1-8) is a wild-type control for the mutation-containing amyloid-β (1-8, A2V) peptide .
- GC35334 Amyloid β Peptide (42-1)(human) 아밀로이드 β 펩티드(42-1)(인간)는 아밀로이드 β의 비활성 형태입니다. 펩티드(1-42).
- GC42802 Amyloid-β (1-8, A2V) Peptide Amyloid-β (1-8, A2V) is a truncated form of amyloid-β (Aβ) that contains a valine to alanine substitution at position 2 of the Aβ numbering convention (Aβ A2V), which corresponds to position 673 of the amyloid precursor protein (APP) numbering convention (APP A673V).
- GC50305 Autocamtide-2-related inhibitory peptide, myristoylated Autocamtide-2 관련 억제 펩티드, myristoylated는 미리스토일화된 Autocamtide-2 관련 억제 펩티드입니다.
- GC47962 PKCε Inhibitor Scramble Peptide A negative control for PKCε inhibitor peptide
- GC50401 RAGE antagonist peptide RAGE 길항제 펩티드는 고급 당화 최종 생성물(RAGE) 길항제입니다.
- GC17329 MLCK inhibitor peptide 18 MLCK 억제제 펩타이드 18은 IC50이 50nM인 미오신 경쇄 키나제(MLCK) 억제제이며 4000배 더 높은 농도에서만 CaM 키나제 II를 억제합니다.
- GC10927 CGRP 8-37 (rat) CGRP 8-37(쥐)(VTHRLAGLLSRSGGVVKDNFVPTNVGSEAF)은 고도로 선택적인 CGRP 수용체 길항제입니다.
- GC43130 CALP3 (trifluoroacetate salt) CALP3 is a calcium-like peptide that contains the first eight residues of CALP2, which is a 12-residue peptide that interacts with EF hand motif 4 in human calmodulin to activate it in the absence of calcium.
- GC16243 β-Amyloid (1-42), human TFA β-Amyloid (1-42), human TFA (Amyloid β-Peptide (1-42) (human) TFA)는 알츠하이머병의 발병기전에 중요한 역할을 하는 42-아미노산 펩타이드입니다.
-
GC11058
Scrambled 10Panx
Panx-1 mimetic inhibitory peptide, blocks pannexin-1 gap junctions
- GC13863 10Panx A peptide inhibitor of PANX1
-
GP10119
Gap 27
A connexin-mimetic peptide
-
GP10130
Myelin Basic Protein (87-99)
An encephalitogenic peptide
- GC26093 α-Conotoxin GI α-Conotoxin GI, a 13-residue peptide originally isolated from the venom of the fish-hunting cone snail Conus geographus, acts as a competitive antagonist for the muscle-type nicotinic acetylcholine receptor (nAChR) with excellent selectivity for α/δ receptor subunit binding over α/γ.
- GC52453 Orexin A (17-33) (human, mouse, rat, bovine) (trifluoroacetate salt) A peptide orexin receptor 1 agonist
- GC52419 MOG (35-55) (mouse, rat) (trifluoroacetate salt) An MOG antigen peptide
- GC52414 [Ala17]-MCH (trifluoroacetate salt) An MCH-derived peptide and MCH receptor agonist
- GC52412 TT-232 (trifluoroacetate salt) A synthetic peptide derivative of somatostatin
- GC52390 Spexin 1 (human, mouse, rat, bovine) (acetate) An endogenous peptide and agonist of GAL2 and GAL3
- GC52389 Caveolin-1 (82-101) amide (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) A synthetic peptide fragment of caveolin-1
- GC52382 Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt) A peptide fragment of Nogo-A
- GC52354 Tertiapin Q (trifluoroacetate salt) A peptide derivative of tertiapin
- GC52100 (Arg)9 (trifluoroacetate salt) A cationic cell-penetrating peptide
- GC49913 Davunetide (acetate) A neuroprotective ADNP-derived peptide
- GC49909 Met-Enkephalinamide (trifluoroacetate salt) A peptide opioid receptor agonist
- GC49882 Hemokinin 1 (human) (trifluoroacetate salt) A peptide agonist of NK1 receptors
- GC49881 Setmelanotide (trifluoroacetate salt) A peptide agonist of MC4R
- GC49705 Pentapeptide-18 (acetate) A peptide derivative of enkephalin
- GC49493 IRL 1620 (trifluoroacetate salt) A peptide ETB receptor agonist
- GC49422 PAR2 (1-6) amide (human) (trifluoroacetate salt) A peptide agonist of PAR2
- GC49416 Gap 27 (trifluoroacetate salt) A connexin-mimetic peptide
- GC49338 Deltorphin II (trifluoroacetate salt) A peptide agonist of δ2-opioid receptors
- GC49264 Neuromedin U-23 (rat) (trifluoroacetate salt) A peptide NMUR agonist
- GC49263 Ac2-26 (human) (ammonium salt) An annexin A1-mimetic peptide
- GC49261 Litorin (trifluoroacetate salt) A peptide with diverse biological activities
- GC49209 Antisauvagine-30 (trifluoroacetate salt) A peptide CRF2 antagonist
- GC49154 Galanin (2-11) amide (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) A synthetic peptide fragment of galanin and an agonist of the GAL2 receptor
- GC49123 Somatorelin (1-44) amide (human) (trifluoroacetate salt) A synthetic GHRH peptide
- GC49120 Prosaptide TX14(A) (trifluoroacetate salt) A peptide fragment of prosaposin and GPR37L1 and GPR37 agonist
- GC48401 Risuteganib (trifluoroacetate salt) An anti-integrin peptide
- GC48399 MTP 131 (acetate) A mitochondria-targeted peptide antioxidant
- GC48358 Thymulin (acetate hydrate) A peptide hormone
- GC48348 Carbetocin (acetate) 옥시토신(OT) 유사체인 카르베토신(아세테이트)은 Ki가 7.1nM인 옥시토신 수용체 작용제입니다.
- GC48292 α-MSH (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) α-MSH(⋱-멜라닌 세포 자극 호르몬) TFA는 내인성 신경 펩티드이며 항염 및 해열 활성을 갖는 내인성 멜라노코르틴 수용체 4(MC4R) 작용제입니다.
- GC47188 Dermorphin (acetate) An opioid peptide
- GC47097 CJC-1295 A synthetic peptide derivative of GHRH
- GC45750 Thymosin β4 (human, mouse, rat, porcine, bovine) (acetate) An actin-sequestering peptide
- GC45565 Semax
- GC45434 Dipeptide diaminobutyroyl benzylamide (acetate)
- GC45234 β-Endorphin (1-27) (human) (trifluoroacetate salt) β-Endorphin (1-27) is an endogenous peptide that binds to μ-, δ-, and κ-opioid receptors (Kis = 5.31, 6.17, and 39.82 nM, respectively, in COS-1 cells expressing rat receptors).
- GC45139 Vapreotide (trifluoroacetate salt) Vapreotide is a peptide neurokinin-1 receptor (NK1) antagonist and analog of somatostatin (IC50 = 330 nM in a radioligand binding assay).
- GC45096 Tyr-α-CGRP (human) (trifluoroacetate salt) Tyr-α-CGRP is an N-terminal extended tyrosinated analogue of α-calcitonin gene-related peptide.
- GC44914 Somatostatin-14 (acetate) Somatostatin-14 is a natural cyclic peptide hormone derived from the preprohormone, somatostatin.
- GC44674 Pramlintide (acetate hydrate) Pramlintide is a non-amyloidogenic analog of the antidiabetic peptide hormone amylin that contains proline residues substituted at positions 25, 28, and 29.
- GC44533 PACAP (6-27) (human, chicken, mouse, ovine, porcine, rat) (trifluoroacetate salt) Pituitary adenylate cyclase-activating peptide (PACAP) (6-27) is a PACAP receptor antagonist with IC50 values of 1,500, 600, and 300 nM, respectively, for rat PAC1, rat VPAC1, and human VPAC2 recombinant receptors expressed in CHO cells.
- GC44531 PACAP (1-27) (human, mouse, ovine, porcine, rat) (trifluoroacetate salt) Pituitary adenylate cyclase-activating peptide (PACAP) (1-27) is a PACAP receptor agonist with IC50 values of 3, 2, and 5 nM, respectively, for rat PAC1, rat VPAC1, and human VPAC2 recombinant receptors expressed in CHO cells.
- GC44374 Neuromedin B (trifluoroacetate salt) Neuromedin B (NMB) is a peptide agonist of the NMB receptor (Ki = 7.4 nM in NCI-H1299 small cell lung cancer cells expressing the human receptor).
- GC44257 Myelin Basic Protein (87-99) (human, bovine, rat) (trifluoroacetate salt) Myelin basic protein (MPB) (87-99) is an encephalitogenic peptide.
- GC43220 Cdk5 Substrate Cyclin-dependent kinase 5 (Cdk5) is a serine/threonine kinase that is predominantly active in neuronal tissues.
- GC43215 CCK Octapeptide (non-sulfated), (trifluoroacetate salt) Cholecystokinin (CCK) octapeptide is a peptide hormone found in the intestine and brain that stimulates digestion, mediates satiety, and is involved in anxiety.
- GC43214 CCK (26-31) (non-sulfated) CCK (26-31) is an N-terminal fragment of CCK , a peptide hormone found in the intestine and brain that stimulates digestion, mediates satiety, and is involved in anxiety.
- GC43213 CCK (26-30) (sulfated) CCK (26-30) is an N-terminal fragment of CCK, a peptide hormone found in the intestine and brain that stimulates digestion, mediates satiety, and is involved in anxiety.
- GC43129 CALP1 (trifluoroacetate salt) CALP1 is an 8-residue calcium-like peptide that interacts with an EF hand motif based on the troponin C superfamily calcium binding site.
- GC42973 Brain-Derived Basic Fibroblast Growth Factor (1-24) (bovine) (trifluoroacetate salt) Brain-derived basic fibroblast growth factor (1-24) (brain-derived bFGF) is a peptide fragment of brain-derived bFGF.
- GC42972 Brain-Derived Acidic Fibroblast Growth Factor (1-11) (bovine) (trifluoroacetate salt) Brain-derived acidic fibroblast growth factor (brain-derived aFGF) (1-11) is a peptide fragment of brain-derived aFGF.
- GC42971 Brain-Derived Acidic Fibroblast Growth Factor (102-111) (bovine) (trifluoroacetate salt) Brain-derived acidic fibroblast growth factor (102-111) is a peptide fragment of brain-derived acidic fibroblast growth factor (aFGF).
-
GC42809
Angiotensin II (3-8) (human, rat, mouse) (trifluoroacetate salt)
Angiotensin II (3-8) is an endogenous C-terminal fragment of the peptide vasoconstrictor angiotensin II.
- GC42796 Amylin (human) (trifluoroacetate salt) Amylin is a 37-residue peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety.
- GC18553 CCK (26-31) (sulfated) CCK (26-31) is an N-terminal fragment of CCK , a peptide hormone found in the intestine and brain that stimulates digestion, mediates satiety, and is involved in anxiety.
- GC18384 CCK (27-33) (non-sulfated) CCK (27-33) is a C-terminal fragment of CCK , a peptide hormone found in the intestine and brain that stimulates digestion, mediates satiety, and is involved in anxiety.
- GC13222 N-Acetylglycyl-D-glutamic acid Excitatory peptide that induces seizures
- GC12366 LPYFD-NH2 펜타펩티드인 LPYFD-NH2는 Aβ(1-42)의 응집에 약간의 억제 효과를 발휘합니다.
- GC14854 Colivelin Colivelin은 뇌 침투성 신경 보호 펩타이드이자 STAT3의 강력한 활성제이며 시험관 내에서 STAT3를 활성화하여 신경 세포 사멸을 억제합니다.
- GC11738 Neurokinin A (porcine) 타키키닌 계열의 펩티드 신경전달물질인 뉴로키닌 A(돼지)(물질 K)는 NK-2 수용체를 통해 작용합니다.