- Cat.No. 상품명 정보
-
GP10118
Amyloid Beta-Peptide (1-40) (human)
인간 Amyloid β-Peptide (1-40) (C194H295N53O58S1)은 H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH 시퀀스를 가진 펩타이드로, 분자량은 4329.8입니다. 아밀로이드 베타(Aβ 또는 Abeta)는 아밀로이드 전구 단백질에서 처리된 36~43개의 아미노산으로 이루어진 펩타이드입니다.
-
GP10082
Amyloid Beta-peptide (25-35) (human)
알츠하이머 아밀로이드 베타 펩타이드의 단편인 인간 Amyloid beta-peptide (25-35)은 신경독성 효과가 있습니다.
- GP10094 Amyloid β-peptide (10-35), amide
-
GP10046
Amyloid Precursor C-Terminal Peptide
For beta amyloid generation
- GP10049 Amyloid Beta-Peptide (12-28) (human)
- GP10057 Amyloid β-Peptide (10-20) (human)
- GP10101 Beta-Sheet Breaker Peptide iAβ5
- GC42803 Amyloid-β (25-35) Peptide (human) (trifluoroacetate salt) Amyloid-β (25-35) (Aβ (25-35)) is an 11-residue fragment of the Aβ protein that retains the physical and biological characteristics of the full length peptide.
- GC46851 Amyloid-β (1-42) Peptide (trifluoroacetate salt) A 42-amino acid protein fragment of amyloid-β
- GC44987 TAMRA-Amyloid-β (1-42) Peptide (trifluoroacetate salt) TAMRA-Amyloid-β (1-42) peptide is a fluorescently labeled peptide.
- GC42937 Biotin-Amyloid-β (1-42) Peptide (trifluoroacetate salt) Biotin-amyloid-β (1-42) peptide is an affinity probe that allows amyloid-β (1-42) (Aβ42) to be detected or immobilized through interaction with the biotin ligand.
- GC42801 Amyloid-β (1-8) Peptide Amyloid-β (1-8) is a wild-type control for the mutation-containing amyloid-β (1-8, A2V) peptide .
- GC42802 Amyloid-β (1-8, A2V) Peptide Amyloid-β (1-8, A2V) is a truncated form of amyloid-β (Aβ) that contains a valine to alanine substitution at position 2 of the Aβ numbering convention (Aβ A2V), which corresponds to position 673 of the amyloid precursor protein (APP) numbering convention (APP A673V).
-
GP10130
Myelin Basic Protein (87-99)
An encephalitogenic peptide
- GC49913 Davunetide (acetate) A neuroprotective ADNP-derived peptide
- GC49493 IRL 1620 (trifluoroacetate salt) A peptide ETB receptor agonist
- GC44674 Pramlintide (acetate hydrate) Pramlintide is a non-amyloidogenic analog of the antidiabetic peptide hormone amylin that contains proline residues substituted at positions 25, 28, and 29.
- GC42796 Amylin (human) (trifluoroacetate salt) Amylin is a 37-residue peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety.