>>Dulaglutide (LY2189265)

Dulaglutide (LY2189265) (Synonyms: HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG)

Catalog No.GC31520

둘라글루티드(LY-2189265)는 제2형 당뇨병(T2DM) 치료를 위한 신규하고 장기작용성의 글루카곤류 펩타이드 1(GLP-1) 아날로그입니다.

Products are for research use only. Not for human use. We do not sell to patients.

Dulaglutide (LY2189265) Chemical Structure

Cas No.: 923950-08-7

Size 가격 재고 수량
1mg
US$180.00
재고 있음
5mg
US$565.00
재고 있음
10mg
US$900.00
재고 있음

Tel:(909) 407-4943 Email: sales@glpbio.com

고객 리뷰

Based on customer reviews.

  • GlpBio Citations

    GlpBio Citations
  • Bioactive Compounds Premium Provider

    Bioactive Compounds Premium Provider

Sample solution is provided at 25 µL, 10mM.

Description Protocol Chemical Properties Product Documents Related Products

둘라글루티드(LY-2189265)는 제2형 당뇨병(T2DM) 치료를 위한 신규하고 장기작용성인 글루카곤류 펩타이드 1(GLP-1) 아날로그입니다. [1]

Dulaglutide (LY2189265)은 PA 처리된 HepG2 세포에서 간 내 지질 축적을 유의하게 감소시키고, 지방 드롭릿 결합 단백질, 신규 리포제네시스 및 TG 합성과 관련된 유전자 발현을 감소시켰습니다. Dulaglutide (LY2189265)는 또한 PA 처리된 세포에서 리포리시스와 지방산 산화와 관련된 단백질 및 FAM3A의 발현을 증가시켰습니다[8]. Dulaglutide (LY2189265)는 Aβ 플라크를 포식하고 제거하기 위해 미세교모세포를 활성화하는 것도 유의미하게 촉진합니다. 게다가, Dulaglutide (LY2189265) 치료는 TNF-α, 인터루킨 -1β 및 IL-6과 같은 염증 인자의 생성 억제를 촉진하면서 Aβ1-42에 영향을 받은 경우 IL-10과 같은 항염증 분자 부담량을 증가 시켰습니다[9].

Dulaglutide (LY2189265) 투여는 노화된 쥐의 tibialis anterior (TA) 및 quadriceps (QD) 근육에서 OPA-1-TLR-9 신호전달 경로를 통해 염증을 감소시켜 근육 소모를 완화하고 근력을 회복시킵니다[3]. Dulaglutide (LY2189265)는 혈청 SHBG 함량과 3βHSD, CYP19α1, StAR 관련 유전자 및 단백질 발현 조절을 통해 PCOS 쥐의 과다한 작은 폴리클 및 난소 낭종 형성 억제하여 PCOS 쥐의 다낭성 난소 개선에 기여함으로써 PCOS 쥐의 과다 안드로겐증을 줄일 수 있습니다[4]. Dulaglutide (LY2189265)는 9주령 수컷 와일드타입 C57/BL6 마우스(AD mice)에서 학습과 기억 능력을 개선합니다[2].

피하 주사 후, Dulaglutide (LY2189265)는 천천히 흡수되었으며 안정 상태에서의 tmax는 24~72시간(중앙값 = 48시간) 범위였습니다 [5,6]. 절대 생체 이용도는 47%이며 반감기는 약 4.7일로 추정되었습니다. 용량 투여 후 2~4주 사이에 안정 상태가 달성되었으며 축적 비율은 대략 1.56이었습니다[7].

References:
[1]:Jimenez-Solem E, Rasmussen MH, et,al. Dulaglutide, a long-acting GLP-1 analog fused with an Fc antibody fragment for the potential treatment of type 2 diabetes. Curr Opin Mol Ther. 2010 Dec;12(6):790-7. PMID: 21154170.
[2]: Jiang Guo-Jing, ZHOU Mei, et,al. Protective effects of dura glycopeptide on learning and memory loss and synaptic degeneration in AD mice [J]. Medical theory & practice,2021,34(14):2365-2368.
[3]: Khin PP, Hong Y, et,al. Dulaglutide improves muscle function by attenuating inflammation through OPA-1-TLR-9 signaling in aged mice. Aging (Albany NY). 2021 Sep 19;13(18):21962-21974. doi: 10.18632/aging.203546. Epub 2021 Sep 19. PMID: 34537761; PMCID: PMC8507261.
[4]: Wu LM, Wang YX, et,al. Dulaglutide, a long-acting GLP-1 receptor agonist, can improve hyperandrogenemia and ovarian function in DHEA-induced PCOS rats. Peptides. 2021 Nov;145:170624. doi: 10.1016/j.peptides.2021.170624. Epub 2021 Aug 8. PMID: 34375684.
[5]: Barrington P, Chien JY, et,al. A 5-week study of the pharmacokinetics and pharmacodynamics of LY2189265, a novel, long-acting glucagon-like peptide-1 analogue, in patients with type 2 diabetes. Diabetes Obes Metab. 2011 May;13(5):426-33. doi: 10.1111/j.1463-1326.2011.01364.x. Epub 2011 Jan 19. PMID: 21251178.
[6]: Barrington P, Chien JY, et,al. LY2189265, a long-acting glucagon-like peptide-1 analogue, showed a dose-dependent effect on insulin secretion in healthy subjects. Diabetes Obes Metab. 2011 May;13(5):434-8. doi: 10.1111/j.1463-1326.2011.01365.x. Epub 2011 Jan 19. PMID: 21251179.
[7]: Scheen AJ. Dulaglutide (LY-2189265) for the treatment of type 2 diabetes. Expert Rev Clin Pharmacol. 2016;9(3):385-99. doi: 10.1586/17512433.2016.1141046. Epub 2016 Feb 6. PMID: 26761217.
[8]: Lee J, Hong SW, et,al. Dulaglutide Ameliorates Palmitic Acid-Induced Hepatic Steatosis by Activating FAM3A Signaling Pathway. Endocrinol Metab (Seoul). 2022 Feb;37(1):74-83. doi: 10.3803/EnM.2021.1293. Epub 2022 Feb 9. PMID: 35144334; PMCID: PMC8901965.
[9]: Wang Y, Han B. Dulaglutide Alleviates Alzheimer's Disease by Regulating Microglial Polarization and Neurogenic Activity. Comb Chem High Throughput Screen. 2022 Jul 26. doi: 10.2174/1386207325666220726163514. Epub ahead of print. PMID: 35894460.

리뷰

Review for Dulaglutide (LY2189265)

Average Rating: 5 ★★★★★ (Based on Reviews and 22 reference(s) in Google Scholar.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%
Review for Dulaglutide (LY2189265)

GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.

Required fields are marked with *

You may receive emails regarding this submission. Any emails will include the ability to opt-out of future communications.