Search Site
  • 0
    장바구니

    Click Here to Find How Many Items You Have Added:)

    image loader

    Adding item(s) to cart......

홈 >> Signaling Pathways >> Neuroscience >> Alzheimer

Alzheimer

Alzheimer

Alzheimer

Alzheimer’s disease (AD), a neurodegenerative disorder, is the most common cause of progressive dementia. Two microscopic characteristics of AD are extracellular amyloid plaques and intracellular neurofibrillary tangles. Amyloid β peptide (Aβ), derived from amyloid precursor protein (APP) by sequential protein cleavage, and other metabolites deposit around neurons and form amyloid plaques, which contribute to the disease’s pathogenesis. The neurofibrillary tangles are formed by the aggregation of phosphorylated tau proteins. Under pathogenic conditions, tau accumulates in dendritic spines and interferes with neurotransmission. The Aβoligomer promotes tau enrichment and facilitates disease progress.

Products for  Alzheimer

  1. Cat.No. 상품명 정보
  2. GC11965 (±)-Huperzine A A neuroprotective AChE inhibitor (±)-Huperzine A Chemical Structure
  3. GC46451 16F16 A PDI inhibitor 16F16 Chemical Structure
  4. GC18817 3β-hydroxy-5-Cholestenoic Acid 3β-hydroxy-5-Cholestenoic acid is an active metabolite of cholesterol formed when cholesterol is metabolized by the cytochrome P450 (CYP) isomer CYP27A1. 3β-hydroxy-5-Cholestenoic Acid Chemical Structure
  5. GC40053 5α,6α-epoxy Cholestanol An oxysterol and a metabolite of cholesterol produced by oxidation 5α,6α-epoxy Cholestanol Chemical Structure
  6. GC52172 5-hydroxy Indole-3-acetic Acid-d6 5-hydroxy Indole-3-acetic Acid-d6 Chemical Structure
  7. GC46720 6,9-Dichloro-1,2,3,4-tetrahydroacridine A synthetic intermediate in the synthesis of AChE inhibitors 6,9-Dichloro-1,2,3,4-tetrahydroacridine Chemical Structure
  8. GC42584 6-O-desmethyl Donepezil 6-O-desmethyl Donepezil is an active metabolite of the acetylcholinesterase inhibitor donepezil. 6-O-desmethyl Donepezil Chemical Structure
  9. GC40587 8,12-iso-iPF2α-VI 8,12-iso-iPF2α-VI is an isoprostane produced by non-enzymatic, free radical-induced peroxidative damage to membrane lipids. 8,12-iso-iPF2α-VI Chemical Structure
  10. GC45378 Alaproclate (hydrochloride)   Alaproclate (hydrochloride) Chemical Structure
  11. GC40024 Altenusin 알테누신은 현저하게 DPPH 라디칼 소거 활성을 나타낸다. Altenusin Chemical Structure
  12. GC42796 Amylin (human) (trifluoroacetate salt) Amylin is a 37-residue peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety. Amylin (human) (trifluoroacetate salt) Chemical Structure
  13. GP10099 amyloid A protein fragment [Homo sapiens] Apolipoproteins related to HDL in plasma amyloid A protein fragment [Homo sapiens] Chemical Structure
  14. GP10118 Amyloid Beta-Peptide (1-40) (human)

    인간 Amyloid β-Peptide (1-40) (C194H295N53O58S1)은 H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH 시퀀스를 가진 펩타이드로, 분자량은 4329.8입니다. 아밀로이드 베타(Aβ 또는 Abeta)는 아밀로이드 전구 단백질에서 처리된 36~43개의 아미노산으로 이루어진 펩타이드입니다.

     Amyloid Beta-Peptide (1-40) (human) Chemical Structure
  15. GP10049 Amyloid Beta-Peptide (12-28) (human) Amyloid Beta-Peptide (12-28) (human) Chemical Structure
  16. GP10082 Amyloid Beta-peptide (25-35) (human)

    알츠하이머 아밀로이드 베타 펩타이드의 단편인 인간 Amyloid beta-peptide (25-35)은 신경독성 효과가 있습니다.

     Amyloid Beta-peptide (25-35) (human) Chemical Structure
  17. GP10046 Amyloid Precursor C-Terminal Peptide

    For beta amyloid generation

     Amyloid Precursor C-Terminal Peptide Chemical Structure
  18. GP10057 Amyloid β-Peptide (10-20) (human) Amyloid β-Peptide (10-20) (human) Chemical Structure
  19. GP10094 Amyloid β-peptide (10-35), amide Amyloid β-peptide (10-35), amide Chemical Structure
  20. GP10097 Amyloid β-Protein (1-15) Amyloid β-Protein (1-15) Chemical Structure
  21. GC46851 Amyloid-β (1-42) Peptide (trifluoroacetate salt) A 42-amino acid protein fragment of amyloid-β Amyloid-β (1-42) Peptide (trifluoroacetate salt) Chemical Structure
  22. GC42801 Amyloid-β (1-8) Peptide Amyloid-β (1-8) is a wild-type control for the mutation-containing amyloid-β (1-8, A2V) peptide . Amyloid-β (1-8) Peptide Chemical Structure
  23. GC42802 Amyloid-β (1-8, A2V) Peptide Amyloid-β (1-8, A2V) is a truncated form of amyloid-β (Aβ) that contains a valine to alanine substitution at position 2 of the Aβ numbering convention (Aβ A2V), which corresponds to position 673 of the amyloid precursor protein (APP) numbering convention (APP A673V). Amyloid-β (1-8, A2V) Peptide Chemical Structure
  24. GC42803 Amyloid-β (25-35) Peptide (human) (trifluoroacetate salt) Amyloid-β (25-35) (Aβ (25-35)) is an 11-residue fragment of the Aβ protein that retains the physical and biological characteristics of the full length peptide. Amyloid-β (25-35) Peptide (human) (trifluoroacetate salt) Chemical Structure
  25. GP10083 Beta-Amyloid (1-11) Beta-Amyloid (1-11) Chemical Structure
  26. GP10101 Beta-Sheet Breaker Peptide iAβ5 Beta-Sheet Breaker Peptide iAβ5 Chemical Structure
  27. GC42937 Biotin-Amyloid-β (1-42) Peptide (trifluoroacetate salt) Biotin-amyloid-β (1-42) peptide is an affinity probe that allows amyloid-β (1-42) (Aβ42) to be detected or immobilized through interaction with the biotin ligand. Biotin-Amyloid-β (1-42) Peptide (trifluoroacetate salt) Chemical Structure
  28. GC46997 C22 Galactosylceramide (d18:1/22:0) A sphingolipid C22 Galactosylceramide (d18:1/22:0) Chemical Structure
  29. GC43274 Citromycetin 시트로마이세틴은 호주 해양 유래 및 육상 Penicillium spp의 방향족 폴리케타이드 화합물입니다. Citromycetin Chemical Structure
  30. GP10010 COG 133 COG 133 Chemical Structure
  31. GC43322 CRANAD 28 CRANAD 28은 아밀로이드 베타 플라크의 시각화를 위한 강력한 형광 화합물입니다. CRANAD 28 Chemical Structure
  32. GC49557 Cu-GTSM A copper-containing compound with diverse biological activities Cu-GTSM Chemical Structure
  33. GC12942 DAPT (GSI-IX)

    γ-시크레타아제 억제제

     DAPT (GSI-IX) Chemical Structure
  34. GC49913 Davunetide (acetate) A neuroprotective ADNP-derived peptide Davunetide (acetate) Chemical Structure
  35. GC45765 Deferiprone-d3 An internal standard for the quantification of deferiprone Deferiprone-d3 Chemical Structure
  36. GC47186 Deoxy Donepezil (hydrochloride) A potential impurity found in bulk preparations of donepezil Deoxy Donepezil (hydrochloride) Chemical Structure
  37. GC43494 DL-threo-PDMP (hydrochloride) DL-threo PDMP is a mixture of ceramide analogs that contains two of the four possible stereoisomers of PDMP : D-threo (1R,2R) and L-threo (1S,2S) PDMP. DL-threo-PDMP (hydrochloride) Chemical Structure
  38. GC47263 Donecopride (fumarate hydrate) A 5-HT4 receptor partial agonist and AChE inhibitor Donecopride (fumarate hydrate) Chemical Structure
  39. GC40018 Donepezil N-oxide Donepezil N-oxide is an active metabolite of the acetylcholinesterase inhibitor donepezil. Donepezil N-oxide Chemical Structure
  40. GC47264 Donepezil-d4 (hydrochloride) An internal standard for the quantification of donepezil Donepezil-d4 (hydrochloride) Chemical Structure
  41. GC43700 FSB FSB는 사상 타우를 검출하고 인간 아밀로이드 병변을 높은 감도와 특이도로 표지하는 데 사용할 수 있는 형광 염료입니다(여기: 390 nm, 방출: 520 nm). FSB Chemical Structure
  42. GC43708 Fulvic Acid 풀빅애씨드(Fulvic Acid)는 토양의 미생물에 의해 생성되는 휴믹 물질에서 나오는 천연 제품입니다. Fulvic Acid Chemical Structure
  43. GC52047 Fustin Fustinis((±)-Fustin; 3,7,3',4'-Tetrahydroxyflavanone)는 강력한 아밀로이드 β(Aβ) 억제제입니다. Fustin Chemical Structure
  44. GC52078 Galantamine (hydrobromide) An alkaloid with AChE inhibitory and nAChR potentiating activities Galantamine (hydrobromide) Chemical Structure
  45. GC47389 Galantamine-d3 (hydrobromide) An internal standard for the quantification of galantamine Galantamine-d3 (hydrobromide) Chemical Structure
  46. GC49273 Glycerophosphorylethanolamine (sodium salt) An active metabolite of phosphatidylethanolamine Glycerophosphorylethanolamine (sodium salt) Chemical Structure
  47. GC49493 IRL 1620 (trifluoroacetate salt) A peptide ETB receptor agonist IRL 1620 (trifluoroacetate salt) Chemical Structure
  48. GC52027 Isolariciresinol Isolariciresinol((+)-Cyclolariciresinol)은 류머티즘 연구에 사용할 수 있습니다. Isolariciresinol Chemical Structure
  49. GC49306 Isopimaric Acid 이소피마르산은 전도도가 큰 칼슘 활성화 K+(BK) 채널의 강력한 오프너입니다. Isopimaric Acid Chemical Structure
  50. GC18568 JNJ-40418677 JNJ-40418677은 γ-secretase의 경구 활성 조절제로 혈액-뇌 장벽을 통과할 수 있습니다. JNJ-40418677 Chemical Structure
  51. GC49436 L-3-n-Butylphthalide A phthalide with antiplatelet and neuroprotective activities L-3-n-Butylphthalide Chemical Structure
  52. GC47563 L-Glutamic Acid (ammonium salt) An excitatory neurotransmitter L-Glutamic Acid (ammonium salt) Chemical Structure
  53. GC49417 L-Serine-13C3 L-세린-13C3((-)-세린-13C3)은 13C로 표지된 L-세린입니다. L-세린((-)-세린; (S)-세린)은 소위 비필수 아미노산 중 하나로 세포 증식에 중심적인 역할을 합니다. L-Serine-13C3 Chemical Structure
  54. GC49461 L-Serine-d7 An internal standard for the quantification of L-serine L-Serine-d7 Chemical Structure
  55. GC45917 Leucettine L41 류세틴 L41은 이중 특이성 티로신 인산화 조절 키나제 1A(DYRK1A), DYRK2, CDC 유사 키나제 1(CLK1) 및 CLK3(IC50s = 각각 0.04, 0.035, 0.015 및 4.5μM)의 강력한 억제제입니다. ]. Leucettine L41 Chemical Structure
  56. GC19221 Leucomethylene blue Mesylate 경구 활성 2세대 타우 단백질 응집 억제제인 류코메틸렌 블루(TRx0237) 메실레이트(Ki 0.12μM)는 알츠하이머병 연구에 사용할 수 있습니다. Leucomethylene blue Mesylate Chemical Structure
  57. GC40078 Memantine-d6 (hydrochloride) Memantine-d6 is intended for use as an internal standard for the quantification of memantine by GC- or LC-MS. Memantine-d6 (hydrochloride) Chemical Structure
  58. GC44225 ML-345 ML-345는 IC50 값이 188nM인 강력하고 선택적인 인슐린 분해 효소(IDE) 소분자 억제제입니다. ML-345 Chemical Structure
  59. GP10006 Myelin Basic Protein (68-82), guinea pig Myelin Basic Protein (68-82), guinea pig Chemical Structure
  60. GP10130 Myelin Basic Protein (87-99)

    An encephalitogenic peptide

     Myelin Basic Protein (87-99) Chemical Structure
  61. GC44416 N-methyl Mesoporphyrin IX

    페로켈라제 억제제 및 DNA를 위한 턴온 생체센서

     N-methyl Mesoporphyrin IX Chemical Structure
  62. GC47746 NAP 226-90 A metabolite of rivastigmine NAP 226-90 Chemical Structure
  63. GC44399 NIAD-4 NIAD-4 is a fluorescent probe that crosses the blood-brain barrier to bind with high affinity to amyloid-β (Aβ) plaques (Ki = 10 nM). NIAD-4 Chemical Structure
  64. GC52214 Nicotinamide riboside-d4 (triflate)

    An internal standard for the quantification of nicotinamide riboside

     Nicotinamide riboside-d4 (triflate) Chemical Structure
  65. GC49090 Nilvadipine-d4 An internal standard for the quantification of nilvadipine Nilvadipine-d4 Chemical Structure
  66. GC49815 Oleuropein aglycone A polyphenol with diverse biological activities Oleuropein aglycone Chemical Structure
  67. GC49024 Palmitic Acid MaxSpec® Standard A quantitative analytical standard guaranteed to meet MaxSpec® identity, purity, stability, and concentration specifications Palmitic Acid MaxSpec® Standard Chemical Structure
  68. GC49023 Palmitic Acid-d9 MaxSpec® Standard A quantitative analytical standard guaranteed to meet MaxSpec® identity, purity, stability, and concentration specifications Palmitic Acid-d9 MaxSpec® Standard Chemical Structure
  69. GC47955 Phloroglucinol A phenol with diverse biological activities Phloroglucinol Chemical Structure
  70. GC49192 Piracetam-d6 An internal standard for the quantification of piracetam Piracetam-d6 Chemical Structure
  71. GC48362 PMX-205 (trifluoroacetate salt) A potent antagonist of C5aR PMX-205 (trifluoroacetate salt) Chemical Structure
  72. GC44674 Pramlintide (acetate hydrate) Pramlintide is a non-amyloidogenic analog of the antidiabetic peptide hormone amylin that contains proline residues substituted at positions 25, 28, and 29. Pramlintide (acetate hydrate) Chemical Structure
  73. GC46208 Propentofylline 프로펜토필린은 아데노신 흡수를 억제하고 포스포디에스테라제 활성을 차단하는 크산틴 유도체입니다. Propentofylline Chemical Structure
  74. GC49108 Racecadotril-d5 An internal standard for the quantification of racecadotril Racecadotril-d5 Chemical Structure
  75. GC48028 Rasagiline-13C3 (mesylate) An internal standard for the quantification of rasagiline Rasagiline-13C3 (mesylate) Chemical Structure
  76. GC18483 RU-505 RU-505 is an inhibitor of the interaction between amyloid-β (Aβ) and fibrinogen, with a higher efficacy for inhibiting monomeric forms of Aβ bound to fibrinogen over oligomeric forms. RU-505 Chemical Structure
  77. GC12096 Semagacestat (LY450139) A pan γ-secretase inhibitor Semagacestat (LY450139) Chemical Structure
  78. GC40068 Setosusin Setosusin((+)-Setosusin)은 독특한 스피로 융합 3(2H)-푸라논 부분을 특징으로 하는 곰팡이 메로디테르페노이드입니다. Setosusin Chemical Structure
  79. GC45831 SRI-011381 SRI-011381은 경구 활성 TGF-β 신호 작용제로 신경 보호 효과를 나타냅니다. SRI-011381 Chemical Structure
  80. GC52496 Sulfatide (bovine) (sodium salt) A mixture of isolated bovine sulfatides Sulfatide (bovine) (sodium salt) Chemical Structure
  81. GC44968 Sulfatides (bovine) (sodium salt) Sulfatides are endogenous sulfoglycolipids with various biological activities in the central and peripheral nervous systems, pancreas, and immune system. Sulfatides (bovine) (sodium salt) Chemical Structure
  82. GC44987 TAMRA-Amyloid-β (1-42) Peptide (trifluoroacetate salt) TAMRA-Amyloid-β (1-42) peptide is a fluorescently labeled peptide. TAMRA-Amyloid-β (1-42) Peptide (trifluoroacetate salt) Chemical Structure
  83. GC45137 Valproic Acid Acyl-D-Glucuronide Valproic acid acyl-D-glucuronide is the major urinary metabolite of valproic acid. Valproic Acid Acyl-D-Glucuronide Chemical Structure
  84. GC48969 Withanone Withanone은 인지 기능 장애 완화에 다기능 신경 보호 효과가 있는 Withania somnifera 뿌리의 활성 성분입니다. Withanone Chemical Structure

83 Item(s)

페이지 당

내림차순