Search Site
  • 0
    장바구니

    Click Here to Find How Many Items You Have Added:)

    image loader

    Adding item(s) to cart......

홈 >> Signaling Pathways >> Neuroscience >> Neuroscience Peptides

Neuroscience Peptides

Neuroscience

Neurons communicate with each other, effector organs and sensory organs through the neurotransmitter – receptor pathway at synapses. Neurotransmitters can be divided into 4 major groups: 1. Amino acids (glumate, aspartate, serine, glycine and GABA); 2. Monoamines (norepinephrine, epinephrine, dopamine, histamine, and serotonin); 3. Peptides (opioid peptides, substance P, somatostatin); and 4. Others (acetylcholine, NO, nucleosides). read more

Products for  Neuroscience Peptides

  1. Cat.No. 상품명 정보
  2. GP10121 Ac-Endothelin-1 (16-21), human Ac-Endothelin-1 (16-21), human Chemical Structure
  3. GP10109 Adrenorphin Adrenorphin Chemical Structure
  4. GP10102 Adrenorphin, Free Acid Adrenorphin, Free Acid Chemical Structure
  5. GP10076 Agouti-related Protein (AGRP) (25-82), human Agouti-related Protein (AGRP) (25-82), human Chemical Structure
  6. GP10099 amyloid A protein fragment [Homo sapiens] Apolipoproteins related to HDL in plasma amyloid A protein fragment [Homo sapiens] Chemical Structure
  7. GP10118 Amyloid Beta-Peptide (1-40) (human)

    인간 Amyloid β-Peptide (1-40) (C194H295N53O58S1)은 H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH 시퀀스를 가진 펩타이드로, 분자량은 4329.8입니다. 아밀로이드 베타(Aβ 또는 Abeta)는 아밀로이드 전구 단백질에서 처리된 36~43개의 아미노산으로 이루어진 펩타이드입니다.

     Amyloid Beta-Peptide (1-40) (human) Chemical Structure
  8. GP10049 Amyloid Beta-Peptide (12-28) (human) Amyloid Beta-Peptide (12-28) (human) Chemical Structure
  9. GP10082 Amyloid Beta-peptide (25-35) (human)

    알츠하이머 아밀로이드 베타 펩타이드의 단편인 인간 Amyloid beta-peptide (25-35)은 신경독성 효과가 있습니다.

     Amyloid Beta-peptide (25-35) (human) Chemical Structure
  10. GP10046 Amyloid Precursor C-Terminal Peptide

    For beta amyloid generation

     Amyloid Precursor C-Terminal Peptide Chemical Structure
  11. GP10057 Amyloid β-Peptide (10-20) (human) Amyloid β-Peptide (10-20) (human) Chemical Structure
  12. GP10094 Amyloid β-peptide (10-35), amide Amyloid β-peptide (10-35), amide Chemical Structure
  13. GP10097 Amyloid β-Protein (1-15) Amyloid β-Protein (1-15) Chemical Structure
  14. GP10083 Beta-Amyloid (1-11) Beta-Amyloid (1-11) Chemical Structure
  15. GP10051 Beta-Lipotropin (1-10), porcine

    Morphine-like substance

     Beta-Lipotropin (1-10), porcine Chemical Structure
  16. GP10101 Beta-Sheet Breaker Peptide iAβ5 Beta-Sheet Breaker Peptide iAβ5 Chemical Structure
  17. GP10127 Cadherin Peptide, avian

    Role in cell adhesion

     Cadherin Peptide, avian Chemical Structure
  18. GP10010 COG 133 COG 133 Chemical Structure
  19. GP10126 Diazepam-Binding Inhibitor Fragment, human Diazepam-Binding Inhibitor (DBI) Fragment is encoded by the DBI gene in human. Diazepam-Binding Inhibitor Fragment, human Chemical Structure
  20. GP10070 Dynorphin (2-17), amide, porcine Dynorphin (2-17), amide, porcine Chemical Structure
  21. GP10065 Endomorphin-1 Endomorphin-1 Chemical Structure
  22. GP10146 ferritin heavy chain fragment [Multiple species] ferritin heavy chain fragment [Multiple species] Chemical Structure
  23. GP10107 Gap 26 Gap 26 Chemical Structure
  24. GP10119 Gap 27

    A connexin-mimetic peptide

     Gap 27 Chemical Structure
  25. GP10115 GTP-Binding Protein Fragment, G alpha GTP-Binding Protein Fragment, G alpha Chemical Structure
  26. GP10041 Insulin like growth factor II fragment variant Insulin like growth factor II fragment variant has a sequence of Thr-Pro-Thr-Lys-Ser-Glu-Arg. Insulin like growth factor II fragment variant Chemical Structure
  27. GC14612 JNJ-31020028 JNJ-31020028은 인간 및 쥐 Y2 수용체에 대해 각각 pIC50 값이 8.07 및 8.22인 신경펩티드 Y Y2 수용체의 선택적 및 뇌 침투성 길항제입니다. JNJ-31020028 Chemical Structure
  28. GP10103 Laminin (925-933)

    Laminin (925-933)（CDPGYIGSR）는 B1 체인 상의 Laminin 시퀀스입니다.

     Laminin (925-933) Chemical Structure
  29. GP10066 Melanocyte stimulating hormone release inhibiting factor Melanocyte stimulating hormone release inhibiting factor Chemical Structure
  30. GP10006 Myelin Basic Protein (68-82), guinea pig Myelin Basic Protein (68-82), guinea pig Chemical Structure
  31. GP10130 Myelin Basic Protein (87-99)

    An encephalitogenic peptide

     Myelin Basic Protein (87-99) Chemical Structure
  32. GP10011 Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell Chemical Structure
  33. GP10069 Parathyroid hormone (1-34) (human) Parathyroid hormone (1-34) (human) Chemical Structure
  34. GP10106 Parathyroid Hormone (1-34), bovine Parathyroid Hormone (1-34), bovine Chemical Structure
  35. GP10014 parathyroid hormone (7-34) [Homo sapiens]/[Macaca fascicularis]

    Enhancer of blood calcium level

     parathyroid hormone (7-34) [Homo sapiens]/[Macaca fascicularis] Chemical Structure
  36. GP10032 Rac GTPase fragment

    Fragment of small signaling G proteins

     Rac GTPase fragment Chemical Structure
  37. GP10042 Rhodopsin peptide Rhodopsin peptide Chemical Structure
  38. GP10084 type II collagen fragment type II collagen fragment Chemical Structure
  39. GP10017 [Ser25] Protein Kinase C (19-31)

    PKC substrate

     [Ser25] Protein Kinase C (19-31) Chemical Structure
  40. GP10081 α-Endorphin α-Endorphin Chemical Structure
  41. GP10111 β-Pompilidotoxin β-Pompilidotoxin Chemical Structure

40 Item(s)

페이지 당

내림차순