Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt) (Synonyms: NEP1-40, Nogo-40, Nogo-A Inhibitory Peptide, RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2)

Name: Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt)
Brand: GlpBio
SKU: GC52382
Availability: InStock
Rating: 5 (30 reviews)

Catalog No.GC52382

A peptide fragment of Nogo-A

Products are for research use only. Not for human use. We do not sell to patients.

Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt) Chemical Structure

Size

Price

Stock

Qty

1 mg	$55.00	In stock
5 mg	$244.00	In stock
10 mg	$431.00	In stock
25 mg	$945.00	In stock

Tel：(909) 407-4943 Email: sales@glpbio.com

Customer Reviews

Based on customer reviews.

Sample solution is provided at 25 µL, 10mM.

GlpBio Products Cited In Reputable Papers

Nature
610.7931 (2022): 366-372

Nature
618, 1017–1023 (2023)

Cell
183.7 (2020): 1867-1883

Cell Research
31, 1291–1307 (2021)

Cell Research
33, 273–287 (2023)

Cell Research
33, 546–561 (2023)

Molecular Cancer
21.1 (2022): 1-17

Molecular Cancer
21.1 (2022): 1-18

Cancer Cell
39 (2021): 1-16

Cell Host Microbe
30.8 (2022): 1124-1138

Cell Host Microbe
31.5 (2023): 766-780

Cell Host Microbe
31.3 (2023): 418-43

Cell Metabolism
34.2 (2022): 240-255

Ann Rheum Dis
82(4): 533-545 (2023)

Cell Mol Immunol
20, 264–276 (2023)

Adv Funct Mater
33.35 (2023): 2214998

Description Chemical Properties Product Documents

Product Documents

Quality Control & SDS

View current batch:

Purity: >95.00%

Nogo-66 (1-40) is a peptide fragment of Nogo-A that corresponds to the extracellular domain, Nogo-66, which can induce neurite growth cone collapse in oligodendrocytes.^1,2 It is also an antagonist of the Nogo-66 receptor (NgR).² It inhibits binding of the NgR agonist AP-Nogo-66 to, and inhibits growth cone collapse induced by the NgR agonist GST-Nogo-66 in, embryonic day 12 (E12) chick dorsal root ganglia (DRG) explants.² Nogo-66 (1-40) partially reverses axonal outgrowth inhibition induced by purified CNS myelin in E12 chick DRG explants (EC₅₀ = 50 nM). It also induces regeneration of corticospinal tract fibers and improves locomotor function in a rat model of midthoracic spinal cord hemisection injury when administered intrathecally at a dose of 75 µg/kg per day.

1.Lim, M., Shi, J., Wei, Z., et al.Structural characterization of the human Nogo-A functional domains. Solution structure of Nogo-40, a Nogo-66 receptor antagonist enhancing injured spinal cord regenerationEur. J. Biochem.271(17)3512-3522(2004) 2.GrandPrÉ, T., Li, S., and Strittmatter, S.M.Nogo-66 receptor antagonist peptide promotes axonal regenerationNature417(6888)547-551(2002)

Cas No.		SDF	Download SDF
Synonyms	NEP1-40, Nogo-40, Nogo-A Inhibitory Peptide, RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2
Canonical SMILES	OC(C[C@H](NC([C@H](CO)NC([C@H](CCCCN)NC([C@H](CCC(N)=O)NC([C@](NC([C@@H](NC([C@H](CCC(N)=O)NC([C@](NC([C@H](C(C)C)NC(CNC([C@H](CCCCN)NC([C@H](CC(C=C1)=CC=C1O)NC([C@](NC([C@H](CCCNC(N)=N)NC(C)=O)=O)([H])[C@H](CC)C)=O)=O)=O)=O)=O)([H])[C@H](CC)C)=O)=O)C)=O)([H])[C@H](CC)C)=O)=O)=O)=O)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CC2=CNC=N2)C(N3CCC[C@H]3C(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N[C@@H](CC(C=C4)=CC=C4O)C(N[C@H](C(N[C@@H](CCC(O)=O)C(N[C@@H](CO)C(N[C@@H](CCC(O)=O)C(N[C@@H](C(C)C)C(N[C@H](C(N[C@@](C(N[C@@H](CO)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@H](C(N[C@@H](C(C)C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN)C(N[C@@H](CC(C=C5)=CC=C5O)C(N[C@@H](CO)C(N[C@@H](CC(N)=O)C(N[C@@H](CO)C(N)=O)=O)=O)=O)=O)=O)=O)=O)CC(C)C)=O)=O)=O)=O)([H])[C@H](CC)C)=O)C)=O)=O)=O)=O)=O)CC(C)C)=O)=O)C)=O)=O)CC6=CC=CC=C6)=O)=O)=O)=O)=O)=O.OC(C(F)(F)F)=O
Formula	C206H324N56O65 ? CF3COOH	M.Wt	4739.1
Solubility	Water: 1mg/mL	Storage	-20°C
General tips	Please select the appropriate solvent to prepare the stock solution according to the solubility of the product in different solvents; once the solution is prepared, please store it in separate packages to avoid product failure caused by repeated freezing and thawing.Storage method and period of the stock solution: When stored at -80°C, please use it within 6 months; when stored at -20°C, please use it within 1 month. To increase solubility, heat the tube to 37°C and then oscillate in an ultrasonic bath for some time.
Shipping Condition	Evaluation sample solution: shipped with blue ice. All other sizes available: with RT, or with Blue Ice upon request.

Complete Stock Solution Preparation Table

Prepare stock solution
		1 mg	5 mg	10 mg
	1 mM	0.211 mL	1.0551 mL	2.1101 mL
	5 mM	0.0422 mL	0.211 mL	0.422 mL
	10 mM	0.0211 mL	0.1055 mL	0.211 mL

Molarity Calculator
Dilution Calculator

Calculate

In vivo Formulation Calculator (Clear solution)

Step 1: Enter information below (Recommended: An additional animal making an allowance for loss during the experiment)

Dosage: mg/kg

Average weight of animals: g

Dosing volume per animal:μL

Number of animals:

Step 2: Enter the in vivo formulation (This is only the calculator, not formulation. Please contact us first if there is no in vivo formulation at the solubility Section.)

% DMSO + % + % Tween 80 + % ddH₂O

%DMSO+ %

Calculation results:

Working concentration: mg/ml;

Method for preparing DMSO master liquid: mg drug pre-dissolved in μL DMSO ( Master liquid concentration mg/mL, Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug. )

Method for preparing in vivo formulation: Take μL DMSO master liquid, next addμL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH₂O, mix and clarify.

Method for preparing in vivo formulation: Take μL DMSO master liquid, next add μL Corn oil, mix and clarify.

Note: 1. Please make sure the liquid is clear before adding the next solvent.
2. Be sure to add the solvent(s) in order. You must ensure that the solution obtained, in the previous addition, is a clear solution before proceeding to add the next solvent. Physical methods such as vortex, ultrasound or hot water bath can be used to aid dissolving.
3. All of the above co-solvents are available for purchase on the GlpBio website.

Reviews

Review for Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt)

Average Rating: 5 ★★★★★ (Based on Reviews and 30 reference(s) in Google Scholar.)

5 Star

100%

4 Star

3 Star

2 Star

1 Star

Review for Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt)

GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.

Required fields are marked with *

Overall Rating

★

Review Title

Review

Nickname

You may receive emails regarding this submission. Any emails will include the ability to opt-out of future communications.

Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt) (Synonyms: NEP1-40, Nogo-40, Nogo-A Inhibitory Peptide, RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2)

Customer Reviews

GlpBio Citations

Bioactive Compounds Premium Provider