Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt) (Synonyms: NEP1-40, Nogo-40, Nogo-A Inhibitory Peptide, RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2) |
Catalog No.GC52382 |
A peptide fragment of Nogo-A
Products are for research use only. Not for human use. We do not sell to patients.
Sample solution is provided at 25 µL, 10mM.
Nogo-66 (1-40) is a peptide fragment of Nogo-A that corresponds to the extracellular domain, Nogo-66, which can induce neurite growth cone collapse in oligodendrocytes.1,2 It is also an antagonist of the Nogo-66 receptor (NgR).2 It inhibits binding of the NgR agonist AP-Nogo-66 to, and inhibits growth cone collapse induced by the NgR agonist GST-Nogo-66 in, embryonic day 12 (E12) chick dorsal root ganglia (DRG) explants.2 Nogo-66 (1-40) partially reverses axonal outgrowth inhibition induced by purified CNS myelin in E12 chick DRG explants (EC50 = 50 nM). It also induces regeneration of corticospinal tract fibers and improves locomotor function in a rat model of midthoracic spinal cord hemisection injury when administered intrathecally at a dose of 75 µg/kg per day.
1.Lim, M., Shi, J., Wei, Z., et al.Structural characterization of the human Nogo-A functional domains. Solution structure of Nogo-40, a Nogo-66 receptor antagonist enhancing injured spinal cord regenerationEur. J. Biochem.271(17)3512-3522(2004) 2.GrandPrÉ, T., Li, S., and Strittmatter, S.M.Nogo-66 receptor antagonist peptide promotes axonal regenerationNature417(6888)547-551(2002)
Average Rating: 5
(Based on Reviews and 30 reference(s) in Google Scholar.)GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *