Search Site
  • 0
    My Cart

    Click Here to Find How Many Items You Have Added:)

    image loader

    Adding item(s) to cart......

Home >> Peptides

Peptides

Products for  Peptides

  1. Cat.No. Product Name Information
  2. GA24061 Acetyl-(Phe¹)-Octreotide trifluoroacetate salt The peptide is an impurity of octreotide. Acetyl-(Phe¹)-Octreotide trifluoroacetate salt Chemical Structure
  3. GA20526 Acetyl-(Pro¹⁸,Asp²¹)-Amyloid β-Protein (17-21) amide The pentapeptide Ac-LPFFD-NH? (iAβ5p) is an analog of product H-4876 with small chemical modifications which enhance its stability against proteolytic degradation. iAβ5p acts as a β-sheet breaker peptide and crosses the blood-brain barrier at a higher rate than most proteins and peptides known to be selectively taken up by the brain so that it is assumed that the peptide is being specifically transported to the brain. A significant increase in neuronal survival and decrease in brain inflammation associated with the reduction of amyloid plaques in two different transgenic Alzheimer`s disease (AD) models is additionally reported for iAβ5p. Acetyl-(Pro¹⁸,Asp²¹)-Amyloid β-Protein (17-21) amide Chemical Structure
  4. GA20535 Acetyl-Amyloid β-Protein (1-6) amide Experiments using sub-peptides of Aβ42 revealed that the epitope identified by the antibody A8, as described by Ying and coworkers, lies within the 1-6 region of Aβ. The antibody displays high affinity for soluble Aβ42 oligomers in the molecular weight range of 16.5-25 kDa, and detected target antigen in brain sections from senescence-accelerated SAMP 8 mice. Amidated or acetylated and amidated forms of the sequence were used for example for quantitative structure retention relationships (QSRR) experiments. The latter could allow prediction of reversed-phase high-performance liquid chromatography (HPLC) retention of peptides, as reported by Kaliszan and coworkers. Acetyl-Amyloid β-Protein (1-6) amide Chemical Structure
  5. GA20534 Acetyl-Amyloid β-Protein (15-20) amide Incubation of Ac-QKLVFF-NH? with the amyloid β-protein (1-40) inhibited polymerization of the amyloid β-protein (1-40) into amyloid fibrils. The peptide is thought to block the polymerization sites. Acetyl-Amyloid β-Protein (15-20) amide Chemical Structure
  6. GA20533 Acetyl-Amyloid β/A4 Protein Precursor₇₇₀ (96-110) (cyclized) This cyclized peptide which is homologous to the heparin-binding domain of APP, binds strongly to heparin and inhibits binding of ¹²?I-labeled APP to heparin (IC??= 10??M). The peptide blocks the heparan sulfate proteoglycan-dependent stimulatory effect of APP on neurite outgrowth. Acetyl-Amyloid β/A4 Protein Precursor₇₇₀ (96-110) (cyclized) Chemical Structure
  7. GC12152 Acetyl-Calpastatin (184-210) (human) Acetyl-Calpastatin (184-210) (human) Chemical Structure
  8. GA20540 Acetyl-Hirudin (54-65) (sulfated) Acetyl-Hirudin (54-65) (sulfated) binds directly to thrombin-rHCII(L444R) and disrupts interactions between the N-terminal acidic domain of rHCII and anion-binding exosite I of thrombin that serves to stabilize the complex. Acetyl-Hirudin (54-65) (sulfated) Chemical Structure
  9. GA24062 Acetyl-Octreotide Potential impurity of octreotide. Acetyl-Octreotide Chemical Structure
  10. GA20545 Acetyl-Pepstatin Acetyl-pepstatin is reported to be an effective inhibitor of HIV-1 proteinase (Ki = 20 nM at pH 4.7) and of HIV-2 proteinase (Ki = 5 nM at pH 4.7). Ac-Val-Val-Sta-Ala-Sta also inhibits the P. falciparum aspartyl protease plasmepsin II, IC?? 0.6 nM. Acetyl-Pepstatin Chemical Structure
  11. GA24063 Acetyl-PHF6 amide The sequence VQIVYK within the third repeat of tau is essential for fibrillization. Acetyl-PHF6 amide Chemical Structure
  12. GC34387 Acetyl-PHF6 amide TFA

    AcPHF6 TFA; Ac-VQIVYK-NH2 TFA

     Acetyl-PHF6 amide TFA (AcPHF6 TFA) is a tau derived hexapeptide. Acetyl-PHF6 amide TFA Chemical Structure
  13. GC74410 AChRα(97-116) AChRα(97-116), a peptide, can be used to induce experimental autoimmune myasthenia gravis (EAMG). AChRα(97-116) Chemical Structure
  14. GC42713 ACTH (1-10) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)

    Adrenocorticotropic Hormone (1-10), Corticotropin (1-10)

     Adrenocorticotropic hormone (ACTH) (1-10) is an N-terminal peptide fragment of ACTH, a peptide hormone produced by the anterior pituitary gland that is involved in the biological stress response. ACTH (1-10) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) Chemical Structure
  15. GC45372 ACTH (1-13) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)

    SYSMEHFRWGKPV-OH

       ACTH (1-13) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) Chemical Structure
  16. GC35243 ACTH (1-14) TFA

    Adrenocorticotropic Hormone Fragment 1-14 TFA

     ACTH (1-14) TFA Chemical Structure
  17. GC45373 ACTH (1-16) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)

    Adrenocorticotropic Hormone (1-16), SYSMEHFRWGKPVGKK-OH

       ACTH (1-16) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) Chemical Structure
  18. GC45374 ACTH (1-17) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)

    Adrenocorticotropic Hormone (1-17), SYSMEHFRWGKPVGKKR-OH

       ACTH (1-17) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) Chemical Structure
  19. GC35244 ACTH (1-17) TFA

    α1-17-ACTH TFA

     ACTH (1-17) TFA Chemical Structure
  20. GC12239 ACTH (1-39) ACTH (1-39) is a melanocortin receptor agonist. ACTH (1-39) Chemical Structure
  21. GC45375 ACTH (1-39) (trifluoroacetate salt)

    Adrenocorticotropic Hormone (1-39)

       ACTH (1-39) (trifluoroacetate salt) Chemical Structure
  22. GC65350 ACTH (34-39) ACTH (34-39) is an adrenocorticotropic hormone fragment. ACTH (34-39) Chemical Structure
  23. GC40161 ACTH (4-10) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)

    Adrenocorticotropic Hormone (4-10), Corticotropin (4-10)

     Adrenocorticotropic hormone (ACTH) (4-10) is an endogenous peptide fragment of ACTH, a peptide hormone produced by the anterior pituitary gland that is involved in the biological stress response. ACTH (4-10) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) Chemical Structure
  24. GC40132 ACTH (6-24) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)

    HFRWGKPVGKKRRPVKVYP

     ACTH (6-24) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response. ACTH (6-24) (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt) Chemical Structure
  25. GC31925 ACTH 1-13 (Adrenocorticotropic Hormone (1-13))

    Adrenocorticotropic Hormone (1-13)

     ACTH 1-13 (Adrenocorticotropic Hormone (1-13)) is a 13-aa peptide, with cytoprotective effects in the model of ethanol induced gastric lesions in rats. ACTH 1-13 (Adrenocorticotropic Hormone (1-13)) Chemical Structure
  26. GC30547 ACTH 1-14 (Adrenocorticotropic Hormone Fragment 1-14) ACTH 1-14 (Adrenocorticotropic Hormone Fragment 1-14) is a fragment of adrenocorticotrophin, which regulates cortisol and androgen production. ACTH 1-14 (Adrenocorticotropic Hormone Fragment 1-14) Chemical Structure
  27. GC31109 ACTH 1-17 (α1-17-ACTH)

    α1-17-ACTH

     ACTH 1-17 (α1-17-ACTH), an adrenocorticotropin analogue, is a potent human melanocortin 1 (MC1) receptor agonist with a Ki of 0.21 nM. ACTH 1-17 (α1-17-ACTH) Chemical Structure
  28. GC31954 ACTH 11-24 (Adrenocorticotropic Hormone (11-24)) ACTH 11-24 (Adrenocorticotropic Hormone (11-24)) is an adrenocorticotropic hormone (ACTH) receptor antagonist. ACTH 11-24 (Adrenocorticotropic Hormone (11-24)) Chemical Structure
  29. GC31507 ACTH 22-39 (Adrenocorticotropic Hormone (22-39))

    Adrenocorticotropic Hormone (22-39)

     ACTH 22-39 (Adrenocorticotropic Hormone (22-39)) is an adrenocorticotropic hormone (ACTH) fragment. ACTH 22-39 (Adrenocorticotropic Hormone (22-39)) Chemical Structure
  30. GC31530 ACTH 4-11 (Adrenocorticotropic Hormone (4-11), human)

    MEHFRWGK-OH

     ACTH 4-11 (Adrenocorticotropic Hormone (4-11), human), an adrenocorticotropin hormone fragment, possesses a weak α-melanocyte stimulating hormone (α-MSH) potency only at high doses (100 and 1000 nM). ACTH 4-11 (Adrenocorticotropic Hormone (4-11), human) Chemical Structure
  31. GC35245 Activated Protein C (390-404), human Activated Protein C (390-404), human is a peptide of the activated protein C (a vitamin K-dependent serine protease), potently inhibits APC anticoagulant activity. Activated Protein C (390-404), human Chemical Structure
  32. GC35246 Activated Protein C (390-404), human TFA Activated Protein C (390-404), human TFA Chemical Structure
  33. GC74360 ACV Tripeptide TFA ACV Tripeptide TFA is the TFA form of ACV Tripeptide. ACV Tripeptide TFA Chemical Structure
  34. GC68622 Acyl Carrier Protein (ACP) (65-74)

    Acyl Carrier Protein (ACP) (65-74) is an active fragment of the acyl carrier protein ACP.

     Acyl Carrier Protein (ACP) (65-74) Chemical Structure
  35. GC31528 Adipokinetic Hormone (AKH) (24-32), locust Adipokinetic Hormone (AKH) (24-32), locust, isolated from locust corpora cardiaca, is a neurohormone that regulates lipid utilisation during flight. Adipokinetic Hormone (AKH) (24-32), locust Chemical Structure
  36. GC33774 Adrenocorticotropic Hormone (ACTH) (1-10), human Adrenocorticotropic Hormone (ACTH) (1-10), human, an adrenocorticotropin hormone fragment, possesses a weak α-melanocyte stimulating hormone (α-MSH) potency only at high doses (100 and 1000 nM). Adrenocorticotropic Hormone (ACTH) (1-10), human Chemical Structure
  37. GC35253 Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA)

    1-39-Corticotropin (human)(TFA)

     Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) is a melanocortin receptor agonist. Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) Chemical Structure
  38. GC35254 Adrenocorticotropic Hormone (ACTH) (1-39), rat

    ACTH (1-39) (mouse, rat)

     Adrenocorticotropic Hormone (ACTH) (1-39), rat is a potent melanocortin 2 (MC2) receptor agonist. Adrenocorticotropic Hormone (ACTH) (1-39), rat Chemical Structure
  39. GC33788 Adrenocorticotropic Hormone (ACTH) (18-39), human (CLIP (human))

    Adrenocorticotropic Hormone (18-39), Corticotropin-like Intermediate Lobe Peptide, RPVKVYPNGAEDESAEAFPLEF

     Adrenocorticotropic Hormone (ACTH) (18-39), human (CLIP (human)) is a corticotropinlike intermediate lobe peptide, which is produced in the melanotrophs of the intermediate lobe of the pituitary. Adrenocorticotropic Hormone (ACTH) (18-39), human (CLIP (human)) Chemical Structure
  40. GC65059 Adrenocorticotropic Hormone (ACTH) (18-39), human TFA

    CLIP (human) (TFA)

     Adrenocorticotropic Hormone (ACTH) (18-39), human TFA is a corticotropinlike intermediate lobe peptide, which is is produced in the melanotrophs of the intermediate lobe of the pituitary. Adrenocorticotropic Hormone (ACTH) (18-39), human TFA Chemical Structure
  41. GC33790 Adrenocorticotropic Hormone (ACTH) (4-10), human Adrenocorticotropic Hormone (ACTH) (4-10), human is a melanocortin 4 (MC4R) receptor agonist. Adrenocorticotropic Hormone (ACTH) (4-10), human Chemical Structure
  42. GC42737 Adrenomedullin (1-12) (human) (trifluoroacetate salt) Adrenomedullin (1-12) is an N-terminal fragment of adrenomedullin (1-52). Adrenomedullin (1-12) (human) (trifluoroacetate salt) Chemical Structure
  43. GC42739 Adrenomedullin (1-50) amide (rat) (trifluoroacetate salt) Adrenomedullin (1-50) is a peptide hormone with RNA expressed in rat adrenal glands, lung, kidney, heart, and spleen, as well as in the duodenum and submandibular glands. Adrenomedullin (1-50) amide (rat) (trifluoroacetate salt) Chemical Structure
  44. GC34230 Adrenomedullin (1-50), rat Adrenomedullin (1-50), rat is a 50 amino acid peptide, which induces a selective arterial vasodilation via activation of CGRP1 receptor. Adrenomedullin (1-50), rat Chemical Structure
  45. GC42740 Adrenomedullin (1-52) (human) (trifluoroacetate salt)

    Adrenomedullin (1-52)-NH2

     Adrenomedullin (1-52) is a peptide with diverse biological activities. Adrenomedullin (1-52) (human) (trifluoroacetate salt) Chemical Structure
  46. GC46807 Adrenomedullin (1-52) (porcine) (trifluoroacetate salt)

    YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 (Cys16 and 21 bridge)

     A neuropeptide with diverse biological activities Adrenomedullin (1-52) (porcine) (trifluoroacetate salt) Chemical Structure
  47. GC40158 Adrenomedullin (11-50) (rat) (trifluoroacetate salt) Adrenomedullin (11-50) is a truncated form of rat adrenomedullin. Adrenomedullin (11-50) (rat) (trifluoroacetate salt) Chemical Structure
  48. GC35256 Adrenomedullin (11-50), rat Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of rat adrenomedullin. Adrenomedullin (11-50), rat Chemical Structure
  49. GC42738 Adrenomedullin (13-52) (human) (trifluoroacetate salt) Adrenomedullin (13-52) is a truncated form of adrenomedullin (1-52). Adrenomedullin (13-52) (human) (trifluoroacetate salt) Chemical Structure
  50. GC42741 Adrenomedullin (22-52) (human) (trifluoroacetate salt) Adrenomedullin (22-52) is a C-terminal fragment of adrenomedullin (1-52). Adrenomedullin (22-52) (human) (trifluoroacetate salt) Chemical Structure
  51. GC33955 Adrenomedullin (AM) (1-52), human

    Human adrenomedullin-(1-52)-NH2

     Adrenomedullin (AM) (1-52), human is a 52-amino acid peptide, which affects cell proliferation and angiogenesis in cancer. Adrenomedullin (AM) (1-52), human Chemical Structure
  52. GC32622 Adrenomedullin (AM) (13-52), human Adrenomedullin (AM) (13-52), human is a 40 amino acid peptide, which acts as an endothelium-dependent vasodilator agent. Adrenomedullin (AM) (13-52), human Chemical Structure
  53. GC32615 Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin (human)) Adrenomedullin (AM) (22-52), human, is a NH2-terminal truncated forms of Adrenomedullin, which don’t possess the six-membered ring structure or retain the hypotensive and vasodilator activity. Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin (human)) Chemical Structure
  54. GC11039 AF 12198 Type I IL-1 receptor antagonist AF 12198 Chemical Structure
  55. GC35264 AGA-(C8R) HNG17, Humanin derivative AGA-(C8R) HNG17, Humanin derivative is a potent humanin (HN) derivative. AGA-(C8R) HNG17, Humanin derivative Chemical Structure
  56. GC61526 AGA-(C8R) HNG17, humanin derivative TFA AGA-(C8R) HNG17, humanin derivative TFA is a potent humanin (HN) derivative. AGA-(C8R) HNG17, humanin derivative TFA Chemical Structure
  57. GC14867 Agitoxin 2 Shaker K+ channel blocker, potent Agitoxin 2 Chemical Structure
  58. GC15822 Akt/SKG Substrate Peptide substrate for Akt/PKB Akt/SKG Substrate Peptide Chemical Structure
  59. GC90508 Ala-D-γ-Glu-Lys-D-Ala-D-Ala (trifluoroacetate salt)

    A peptidoglycan pentapeptide

     Ala-D-γ-Glu-Lys-D-Ala-D-Ala (trifluoroacetate salt) Chemical Structure
  60. GC74327 Ala-MPSD TFA Ala-MPSD TFA is a control peptide for MPSD. Ala-MPSD TFA Chemical Structure
  61. GC35282 Alexamorelin Met 1 Alexamorelin Met 1 Chemical Structure
  62. GC68636 Alirinetide

    GM604

    Alirinetide (GM604) is a short peptide consisting of six amino acids. It can cross the blood-brain barrier and is used in research for various neurodegenerative diseases.

     Alirinetide Chemical Structure
  63. GC19584 Alkaline Phosphatase

    10-50units/mg protein(37℃,pH 9.8)

     Alkaline Phosphatase Chemical Structure
  64. GC35291 Allatostatin II Allatostatin II is a decapeptid. Allatostatin II Chemical Structure
  65. GC35292 Allatostatin IV Allatostatin IV is an octapeptide. Allatostatin IV Chemical Structure
  66. GC30940 Allergen Gal d 4 (46-61), chicken (Lysozyme C (46-61) (chicken))

    Lysozyme C (46-61) (chicken)

     Allergen Gal d 4 (46-61), chicken (Lysozyme C (46-61) (chicken)) is a hen egg white lysozyme peptide. Allergen Gal d 4 (46-61), chicken (Lysozyme C (46-61) (chicken)) Chemical Structure
  67. GC74408 Alloferon 1 Alloferon 1 is an antiviral and antitumoral peptide. Alloferon 1 Chemical Structure
  68. GC35304 Alpha 1(I) Collagen (614-639), human Alpha 1(I) Collagen (614-639), human is a peptide fragment of alpha-1 type I collagen. Alpha 1(I) Collagen (614-639), human Chemical Structure
  69. GC32208 ALX 40-4C ALX 40-4C is a small peptide inhibitor of the chemokine receptor CXCR4, inhibits SDF-1 from binding CXCR4 with a Ki of 1 μM, and suppresses the replication of X4 strains of HIV-1; ALX 40-4C Trifluoroacetate also acts as an antagonist of the APJ receptor, with an IC50 of 2.9 μM. ALX 40-4C Chemical Structure
  70. GC34386 ALX 40-4C Trifluoroacetate ALX 40-4C Trifluoroacetate is a small peptide inhibitor of the chemokine receptor CXCR4, inhibits SDF-1 from binding CXCR4 with a Ki of 1 μM, and suppresses the replication of X4 strains of HIV-1; ALX 40-4C Trifluoroacetate also acts as an antagonist of the APJ receptor, with an IC50 of 2.9 μM. ALX 40-4C Trifluoroacetate Chemical Structure
  71. GC49262 Alytesin (trifluoroacetate salt) A neuropeptide with diverse biological activities Alytesin (trifluoroacetate salt) Chemical Structure
  72. GC30514 AMARA peptide AMARA peptide is a substrate for SIK and AMPK. AMARA peptide Chemical Structure
  73. GC34224 AMARA peptide TFA AMARA peptide (TFA) is a substrate for salt-inducible kinase (SIK) and adenosine monophosphate activated protein kinase (AMPK). AMARA peptide TFA Chemical Structure
  74. GC16513 Amylin Amylin, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin Chemical Structure
  75. GC42793 Amylin (1-13) (human, mouse, rat), (trifluoroacetate salt)

    IAPP (1-13) (human, mouse rat), Islet Amyloid Polypeptide (1-13) (human. mouse, rat)

     Amylin (1-13) is a peptide fragment of amylin , which is a peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety. Amylin (1-13) (human, mouse, rat), (trifluoroacetate salt) Chemical Structure
  76. GA20710 Amylin (8-37) (human) Human IAPP (8-37), ATQRLANFLVHSSNNFGAILSSTNVGSNTY-amide, readily forms fibrils in vitro. Amylin (8-37) (human) Chemical Structure
  77. GC42794 Amylin (8-37) (human) (trifluoroacetate salt)

    IAPP (8-37) (human), Islet Amyloid Polypeptide (8-37) (human)

     Amylin (8-37) is a peptide fragment of amylin. Amylin (8-37) (human) (trifluoroacetate salt) Chemical Structure
  78. GC35331 Amylin (8-37), rat

    Amylin (8-37) (mouse, rat)

     Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat Chemical Structure
  79. GA24066 Amylin (free acid) (human)

    IAPP (free acid) (human)

     Amylin (free acid) (human) Chemical Structure
  80. GC42795 Amylin (human) (amidated) (trifluoroacetate salt)

    IAPP (human) (amidated), Islet Amyloid Polypeptide (human) (amidated)

     Amylin is a peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety. Amylin (human) (amidated) (trifluoroacetate salt) Chemical Structure
  81. GC42796 Amylin (human) (trifluoroacetate salt)

    IAPP (human), Islet Amyloid Polypeptide (human)

     Amylin is a 37-residue peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety. Amylin (human) (trifluoroacetate salt) Chemical Structure
  82. GC35332 Amylin (IAPP), feline Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline Chemical Structure
  83. GC60581 Amylin (IAPP), feline TFA Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA Chemical Structure
  84. GC42797 Amylin (rat, mouse) (trifluoroacetate salt)

    IAPP (rat, mouse), Islet Amyloid Polypeptide (rat, mouse)

     Amylin is a 37-residue peptide hormone secreted by pancreatic β-cells that reduces food intake, modifies glycogen synthesis, slows gastric emptying, and increases satiety. Amylin (rat, mouse) (trifluoroacetate salt) Chemical Structure
  85. GC35333 Amylin, amide, rat

    Amylin (rat)

     Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor. Amylin, amide, rat Chemical Structure
  86. GC35334 Amyloid β Peptide (42-1)(human) Amyloid β Peptide (42-1)(human) is the inactive form of Amyloid β Peptide (1-42). Amyloid β Peptide (42-1)(human) Chemical Structure
  87. GC35335 Amyloid β-peptide (1-40) rat Amyloid β-peptide (1-40) rat is a rat form of the amyloid β-peptide, which accumulates as an insoluble extracellular deposit around neurons, giving rise to the senile plaques associated with Alzheimer's disease (AD). Amyloid β-peptide (1-40) rat Chemical Structure
  88. GA20721 Amyloid β-Protein (1-12) Amyloid β-Protein (1-12) Chemical Structure
  89. GA20722 Amyloid β-Protein (1-14) The N-terminal Aβ fragments Aβ1-14, Aβ1-15 (H-6368), and Aβ1-16 (H-2958) are elevated in cell media and in CSF in response to γ-secretase inhibitor treatment. The presence of these small peptides is consistent with a catabolic amyloid precursor protein cleavage pathway by β- followed by α-secretase. It has been shown that Aβ1-14, Aβ1-15, and Aβ1-16 increase dose-dependently in response to γ-secretase inhibitor treatment while Aβ1-42 levels are unchanged. Amyloid β-Protein (1-14) Chemical Structure
  90. GA20724 Amyloid β-Protein (1-24) Amyloid β-Protein (1-24) Chemical Structure
  91. GA20725 Amyloid β-Protein (1-37) Amyloid β-Protein (1-37) correlates moderately with Mini-Mental State Examination (MMSE) scores in Alzheimer disease. Amyloid β-Protein (1-37) Chemical Structure
  92. GA20726 Amyloid β-Protein (1-38) Like Aβ (25-35) (H-1192), the Aβ fragment (1-38) destabilizes calcium homeostasis and renders human cortical neurones vulnerable to environmental insults. Amyloid β-Protein (1-38) Chemical Structure
  93. GA20727 Amyloid β-Protein (1-39) Small quantities of Aβ37, 38 and 39 can be detected in CSF together with Aβ40, the most abundant Aβ homolog, Aβ42, and N-terminally truncated amyloid peptides. The relative amounts depend on the variant of Alzheimer's disease. The C-terminally truncated amyloid peptides are also found in amyloid plaques. Amyloid β-Protein (1-39) Chemical Structure
  94. GA20728 Amyloid β-Protein (1-40) (scrambled) Amyloid β-Protein (1-40) (scrambled) Chemical Structure
  95. GA20729 Amyloid β-Protein (1-40) amide Amyloid β-Protein (1-40) amide Chemical Structure
  96. GA24067 Amyloid β-Protein (1-40)-Lys(biotinyl) amide

    Abeta (1-40) Lys (Biotin) amide

     For immobilization of Aβ40. Amyloid β-Protein (1-40)-Lys(biotinyl) amide Chemical Structure
  97. GA20733 Amyloid β-Protein (1-42)

    Compared to the inner salt, the HCl salt of Aβ42 aggregates more readily at pH 7.4.

     Amyloid β-Protein (1-42) Chemical Structure
  98. GA20731 Amyloid β-Protein (1-42) (scrambled) Amyloid β-Protein (1-42) (scrambled) Chemical Structure
  99. GA24068 Amyloid β-Protein (1-42)-Lys(biotinyl) amide

    Beta-Amyloid (1-42)-Lys(biotin) amide

     For immobilization of Aβ42. Amyloid β-Protein (1-42)-Lys(biotinyl) amide Chemical Structure
  100. GA20736 Amyloid β-Protein (1-43) Amyloid β-Protein (1-43) is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. Amyloid β-Protein (1-43) Chemical Structure
  101. GA20737 Amyloid β-Protein (1-46) Precursor of the secreted amyloid β-protein (1-40) and (1-42). The identification of amyloid-β-protein (1-46) led to the identification of a zeta-cleavage site between the known γ- and ε-cleavage sites within the transmembrane domain of amyloid-β precursor protein (APP). Amyloid β-Protein (1-46) Chemical Structure

Items 401 to 500 of 2391 total

per page
  2. 3
  3. 4
  4. 5
  5. 6
  6. 7

Set Descending Direction