Home >> Signaling Pathways >> GPCR/G protein >> Glucagon Receptor

Glucagon Receptor

Glucagon receptor is a member of the class B G-protein coupled family of receptors and is activated by glucagon, resulting in activation of adenylate cyclase and increased levels of intracellular cAMP.

Products for  Glucagon Receptor

  1. Cat.No. Product Name Information
  2. GC31322 Adomeglivant (LY2409021) Adomeglivant (LY2409021) (LY2409021) is a potent, selective glucagon receptor (GluR) allosteric antagonist. Adomeglivant (LY2409021)  Chemical Structure
  3. GC25046 Albiglutide Fragment Albiglutide fragment is one copy of a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36). Albiglutide Fragment  Chemical Structure
  4. GC16232 BETP glucagon-like peptide 1 (GLP-1) receptor modulator BETP  Chemical Structure
  5. GC39364 Cotadutide acetate Cotadutide (MEDI0382) acetate is a potent dual agonist of glucagon-like peptide-1 (GLP-1) and GCGR with EC50 values of 6.9 pM and 10.2 pM, respectively. Cotadutide acetate  Chemical Structure
  6. GC11646 des-His1-[Glu9]-Glucagon (1-29) amide des-His1-[Glu9]-Glucagon (1-29) amide is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. des-His1-[Glu9]-Glucagon (1-29) amide  Chemical Structure
  7. GC16482 Exendin-3 (9-39) amide Exendin-3 (9-39) amide (Exendin (9-39)) is a specific and competitive GLP-1 receptor antagonist. Exendin-3 (9-39) amide  Chemical Structure
  8. GC60829 Exendin-3/4 (59-86) Exendin-3/4 (59-86) is a Exendin-4 peptide derivative. Exendin-3/4 (59-86)  Chemical Structure
  9. GC13391 Exendin-4

    Exendin-4, a glucagon-like protein-1 (GLP-1) receptor agonist, mimics the activity of mammalian incretin hormone glucagon-like peptide 1 (GLP-1), and thus, promotes insulin secretion and functions in the control of glucose.

    Exendin-4  Chemical Structure
  10. GC43644 Exendin-4 (acetate) Exendin-4 is a potent peptide agonist of the glucagon-like peptide 1 (GLP-1) receptor (Ki = 136 pM). Exendin-4 (acetate)  Chemical Structure
  11. GC34246 FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS  Chemical Structure
  12. GC43761 GLP-1 (1-37) (human, rat, mouse, bovine) (trifluoroacetate salt) GLP-1 (1-37) (human, rat, mouse, bovine) (trifluoroacetate salt) is a highly potent agonist of the GLP-1 receptor. GLP-1 (1-37) (human, rat, mouse, bovine) (trifluoroacetate salt)  Chemical Structure
  13. GC13743 GLP-1 (9-36) amide antagonist at the human GLP-1 receptor GLP-1 (9-36) amide  Chemical Structure
  14. GC34244 GLP-1 moiety from Dulaglutide GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist, extracted from patent US 20160369010 A1. GLP-1 moiety from Dulaglutide  Chemical Structure
  15. GC31363 GLP-1 receptor agonist 1 GLP-1 receptor agonist 1 (GLP-1 receptor agonist 1) is a GLP-1 receptor agonist extracted from patent WO2018056453A1, Compound 67. GLP-1 receptor agonist 1  Chemical Structure
  16. GC36147 GLP-1 receptor agonist 2 GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist. GLP-1 receptor agonist 2  Chemical Structure
  17. GC61545 GLP-1(28-36)amide GLP-1(28-36)amide, a C-terminal nonapeptide of GLP-1, is a major product derived from the cleavage of GLP-1 by the neutral endopeptidase (NEP). GLP-1(28-36)amide  Chemical Structure
  18. GC61540 GLP-1(32-36)amide GLP-1(32-36)amide, a pentapeptide, derived from the C terminus of the glucoregulatory hormone GLP-1. GLP-1(32-36)amide  Chemical Structure
  19. GC33759 GLP-1(7-36) Acetate (Human GLP-1-(7-36)-amide Acetate) GLP-1(7-36) Acetate (Human GLP-1-(7-36)-amide Acetate) is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells. GLP-1(7-36) Acetate (Human GLP-1-(7-36)-amide Acetate)  Chemical Structure
  20. GC60876 GLP-1(7-36), amide TFA GLP-1(7-36), amide TFA is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells. GLP-1(7-36), amide TFA  Chemical Structure
  21. GC30058 GLP-1(7-37) GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion. GLP-1(7-37)  Chemical Structure
  22. GC34904 GLP-1(7-37) acetate GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion. GLP-1(7-37) acetate  Chemical Structure
  23. GC36148 GLP-1R Antagonist 1 GLP-1R Antagonist 1 (compound 5d) is an orally active, CNS penetrant and non-competitive antagonist of glucagon-like peptide 1 receptor (GLP-1R), with an IC50 of 650 nM. GLP-1R Antagonist 1  Chemical Structure
  24. GC16646 GLP-2 (human) GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium. GLP-2 (human)  Chemical Structure
  25. GC13075 GLP-2 (rat) intestinal epithelium-specific growth factor GLP-2 (rat)  Chemical Structure
  26. GC60877 GLP-2(3-33) GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM). GLP-2(3-33)  Chemical Structure
  27. GC33757 Glucagon (Porcine glucagon) Glucagon (Porcine glucagon) is a peptide hormone, produced by pancreatic α-cells. Glucagon (Porcine glucagon)  Chemical Structure
  28. GC15486 glucagon receptor antagonists 1 glucagon receptor antagonists 1  Chemical Structure
  29. GC12569 glucagon receptor antagonists 2 glucagon receptor antagonists 2  Chemical Structure
  30. GC13512 glucagon receptor antagonists 3 glucagon receptor antagonists 3  Chemical Structure
  31. GC19170 Glucagon receptor antagonists-4 Glucagon receptor antagonists-4 is a highly potent, non-peptide and orally active glucagon receptor antagonist. Glucagon receptor antagonists-4  Chemical Structure
  32. GC36150 Glucagon-Like Peptide (GLP) I (7-36), amide, human Glucagon-Like Peptide (GLP) I (7-36), amide, human is a physiological incretin hormone that stimulates insulin secretion. Glucagon-Like Peptide (GLP) I (7-36), amide, human  Chemical Structure
  33. GC36152 Glucagon-like peptide 1 (1-37), human (TFA) Glucagon-like peptide 1 (1-37), human (TFA)  Chemical Structure
  34. GC31379 GRA Ex-25

    A GCGR antagonist

    GRA Ex-25  Chemical Structure
  35. GC34245 GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS  Chemical Structure
  36. GC30254 HAEGTFT HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide. HAEGTFT  Chemical Structure
  37. GC31436 HAEGTFTSD HAEGTFTSD is a 9-residue peptide of human GLP-1 peptide or GLP-1(7-36), amide. HAEGTFTSD  Chemical Structure
  38. GC31416 HAEGTFTSDVS HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide. HAEGTFTSDVS  Chemical Structure
  39. GC34249 KQMEEEAVRLFIEWLKNGGPSSGAPPPS KQMEEEAVRLFIEWLKNGGPSSGAPPPS  Chemical Structure
  40. GC17298 L-168,049 human glucagon receptor (hGR) antagonist L-168,049  Chemical Structure
  41. GC31343 LGD-6972 LGD-6972 is a selective and orally active glucagon receptor antagonist. LGD-6972  Chemical Structure
  42. GC10311 Liraglutide Liraglutide is a highly potent, long-acting GLP-1 receptor agonist (EC50 = 61 pM)and shares 97% of its amino acid sequence identity with human GLP-1 . Liraglutide  Chemical Structure
  43. GC31334 Lixisenatide Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM). Lixisenatide  Chemical Structure
  44. GC10075 Methylprednisolone Sodium Succinate

    glucocorticoid

    Methylprednisolone Sodium Succinate  Chemical Structure
  45. GC14793 MK 0893 MK 0893  Chemical Structure
  46. GC36753 NNC-0640 NNC-0640 is a potent human G-protein-coupled glucagon receptor (GCGR) negative allosteric modulator (NAM) with an IC50 of 69.2 nM. NNC-0640  Chemical Structure
  47. GC16969 Oxyntomodulin Endogenous glucagon-like peptide that modulates feeding and metabolism Oxyntomodulin  Chemical Structure
  48. GC38832 PF-06882961

    PF-06882961 is a potent, orally bioavailable agonist of the glucagon-like peptide-1 receptor (GLP-1R)

    PF-06882961  Chemical Structure
  49. GC38495 Secretin (33-59), rat TFA Secretin (33-59), rat (TFA) is a 27-aa peptide, which acts on secretin receptor, and enhances the secretion of bicarbonate, enzymes, and K+ from the pancreas. Secretin (33-59), rat TFA  Chemical Structure
  50. GC31404 Semaglutide

    Semaglutide is an agonist of the human glucagon-like peptide-1 (GLP-1) receptor.

    Semaglutide  Chemical Structure
  51. GC34328 Semaglutide TFA Semaglutide TFA, a long-acting GLP-1 analogue, is a glucagon-like peptide-1 (GLP-1) receptor agonist. Semaglutide TFA  Chemical Structure
  52. GC31360 Taspoglutide (ITM077) Taspoglutide (ITM077) is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist developed for treatment of type 2 diabetes, with an EC50 value of 0.06 nM. Taspoglutide (ITM077)  Chemical Structure
  53. GC34840 Tirzepatide

    Tirzepatide, a dual glucagon-like peptide-1 (GLP-1) and glucose-dependent insulinotropic polypeptide (GIP) receptor agonist, is a prospective therapy for type 2 diabetes mellitus (T2DM).

    Tirzepatide  Chemical Structure
  54. GC38133 Tirzepatide (TFA) Tirzepatide (TFA)  Chemical Structure
  55. GC38132 Tirzepatide hydrochloride

    Tirzepatide is a dual GIP and GLP-1 receptor agonist capable of inducing GIP and GLP-1 receptor internalization in different ways, with EC50 values of 18.2 nM and 18.1 nM, respectively.

    Tirzepatide hydrochloride  Chemical Structure
  56. GC26027 V-0219 V-0219 is an orally active, positive allosteric modulator (PAM) of the glucagon-like peptide-1 receptor (GLP-1R), can be used for obesity-associated diabetes research. V-0219  Chemical Structure
  57. GC37929 VU0453379 VU0453379 is a highly selective and central nervous system (CNS) penetrant positive allosteric modulator (PAM) of glucagon-like peptide-1R (GLP-1R) with an EC50 of 1.3 μM. VU0453379  Chemical Structure
  58. GC62753 [Des-His1,Glu9]-Glucagon amide TFA [Des-His1,Glu9]-Glucagon amide TFA is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide TFA  Chemical Structure
  59. GC39323 {Val1}-Exendin-3/4 {Val1}-Exendin-3/4 is the first N-terminal 1-28 residues of Exendin-4 peptide. {Val1}-Exendin-3/4  Chemical Structure

58 Item(s)

per page

Set Descending Direction