Tissue Factor Protein, Mouse (HEK293, His) |
| Catalog No.GC26818 |
Tissue factor (TF) initiates blood coagulation by forming a complex with circulating factor VII or VIIa, thus forming the [TF:VIIa] complex.
Products are for research use only. Not for human use. We do not sell to patients.
Sample solution is provided at 25 µL, 10mM.
_1-3.$$$39978408@51.jpg');)
_1-9.$$$38538795@65.jpg');)
_1-9.$$$39112701@51.jpg');)
_1-7.$$$37316672@70.jpg');)
_366-372.$$$36198801@70.jpg');)
.$$$38565142@65.jpg');)
_1867-1883.$$$33248023@67.jpg');)
_eads6055.$$$39977546@45.jpg');)
_eadm9805.$$$40080571@45.jpg');)
_eadj3020.$$$39666821@45.jpg');)
_1-20.$$$39757301@28.jpg');)
_1-24.$$$38898113@28.jpg');)
_273-287.$$$36806353@46.jpg');)
_1-16.$$$37156877@44.jpg');)
_1-19.$$$37460805@44.jpg');)
_1291-1307.$$$34518654@46.jpg');)
Tissue factor (TF) initiates blood coagulation by forming a complex with circulating factor VII or VIIa, thus forming the [TF:VIIa] complex. This complex is capable of specific limited proteolysis of factors IX or X and plays a key role in normal hemostasis by initiating the coagulation protease cascade. Tissue Factor Protein, Mouse (HEK293, His) is the recombinant mouse-derived Tissue Factor protein, expressed by HEK293 , with C-6*His labeled tag.
Tissue Factor (TF) serves as a crucial initiator of blood coagulation through its formation of a complex with circulating factor VII or VIIa. The resulting [TF:VIIa] complex facilitates the specific limited proteolysis of factors IX or X, thereby playing a pivotal role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade. Notably, TF's interaction with HSPE is significant, with heparin acting as an inhibitor; this interaction promotes the generation of activated factor X and activates coagulation in the presence of activated factor VII, underscoring TF's intricate involvement in the regulation of blood clotting processes.
| Purity | Greater than 95% as determined by reducing SDS-PAGE. | Source | HEK293 |
| Phycical Appearance | Lyophilized powder. | Shipping Condition | |
| Synonyms | Tissue factor; TF; Coagulation factor III | ||
| Amino Acid Sequence | AGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGE | ||
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 0.05% Brij35, pH 7.5. | ||
Tissue Factor (TF) serves as a crucial initiator of blood coagulation through its formation of a complex with circulating factor VII or VIIa. The resulting [TF:VIIa] complex facilitates the specific limited proteolysis of factors IX or X, thereby playing a pivotal role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade. Notably, TF's interaction with HSPE is significant, with heparin acting as an inhibitor; this interaction promotes the generation of activated factor X and activates coagulation in the presence of activated factor VII, underscoring TF's intricate involvement in the regulation of blood clotting processes.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Average Rating: 5 (Based on Reviews and 30 reference(s) in Google Scholar.)
GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *