GLPBio

Amyloid β

Amyloid β denotes peptides of 36–43 amino acids result from the APP (amyloid precursor protein) and are involved in Alzheimer's disease as the main component of the amyloid plaques.

Products Related to Amyloid β(118)

  • GC68725 structure
    GC68725Bapineuzumab
    CAS: 648895-38-9
    Purity: >96.00%

    بابينيوزوماب هو أحد أجسام المضادة المونوكلونية لبروتين β-amyloid. يمكن استخدام بابينيوزوماب في الأبحاث حول مرض الزهايمر (AD).

  • GC68996 structure
    GC68996Donanemab
    CAS: 1931944-80-7
    Purity: >97.00%

    دونانيماب (LY3002813) هو أحد الأجسام المضادة المونوكلونية IgG1 الإنسانية التي تستهدف مقعد نهاية N لبروتين بروتين Aβ الشبيه بالصبغة. يحمل دونانيماب إمكانات للاستخدام في دراسات مرض الزهايمر في مراحله المبكرة.

  • GC69150 structure
    GC69150Gantenerumab
    CAS: 1043556-46-2
    Purity: 98.50%

    جانتينيرماب هو أحد أجسام المضادة الأحادية IgG1 ضد بروتين β-amyloid البشري الكامل، والذي يظهر ارتباطًا مستمرًا بβ-amyloid في الدماغ. يُستخدَم جانتينيرماب في دراسات مرض الزهايمر.

  • GC70182 structure
    GC70182β-Amyloid (1-40), FAM-labeled TFA
    Purity: >99.00%

    β-أميلويد (1-40)، FAM-labeled TFA هو ببتيد β-أميلويد (1-40) الملصق بعلامة الفلورسنت FAM (Λex= 492 نانومتر و Λem= 518 نانومتر).

  • GN10307 structure
    GN10307Ginsenoside Re
    CAS: 52286-59-6
    Purity: >99.00%

    Ginsenoside Re is a natural compound found in Panax ginseng , possessing potent antioxidant and anti-inflammatory bioactivities.

  • GN10313 structure
    GN10313Schisantherin B
    CAS: 58546-55-7
    Purity: >99.50%
  • GN10428 structure
    GN10428Geniposide
    CAS: 24512-63-8
    Purity: >99.50%
  • GN10502 structure
    GN10502Saikosaponin C
    CAS: 20736-08-7
    Purity: >98.00%
  • GN10544 structure
    GN10544Ginsenoside Rg1
    CAS: 22427-39-0
    Purity: >98.00%

    Ginsenoside Rg1, one of the main active components found in Panax ginseng, is a class of natural products known as steroid glycosides with a wide range of biological activities.

  • GN10614 structure
    GN10614Ginsenoside Rg2
    CAS: 52286-74-5
    Purity: >98.00%
  • GN10695 structure
    GN10695Notoginsenoside R1
    CAS: 80418-24-2
    Purity: >98.00%

    Notoginsenoside R1 is a major active saponin component isolated from Panax notoginseng and is a key bioactive compound in many traditional Chinese medicine formulations.

  • GN10799 structure
    GN1079920(S)-Ginsenoside Rg3
    CAS: 14197-60-5
    Purity: >98.00%

    20(S)-Ginsenoside Rg3 is a rare ginsenoside extracted from ginseng (Na + : IC 50 = 32.2±4.5μM; hKv1.4: IC 50 = 32.6±2.2μM).

  • GP10046 structure
    GP10046Amyloid Precursor C-Terminal Peptide
    Purity: >98%

    For beta amyloid generation

  • GP10049 structure
    GP10049Amyloid Beta-Peptide (12-28) (human)
    CAS: 107015-83-8
    Purity: >95.00%

    Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)).

  • GP10057 structure
    GP10057Amyloid β-Peptide (10-20) (human)
    CAS: 152286-31-2
    Purity: >98%
  • GP10082 structure
    GP10082Amyloid Beta-peptide (25-35) (human)
    CAS: 131602-53-4
    Purity: >98.50%

    الببتيد بيتا الأميلويد (25-35) (الإنسان) هو جزء من ببتيد أميلويد بيتا في مرض الزهايمر وله تأثيرات عصبية سامة.

  • GP10083 structure
    GP10083Beta-Amyloid (1-11)
    CAS: 190436-05-6
    Purity: >98%
  • GP10094 structure
    GP10094Amyloid β-peptide (10-35), amide
    Purity: >98%
  • GP10097 structure
    GP10097Amyloid β-Protein (1-15)
    CAS: 183745-81-5
    Purity: >98%
  • GP10099 structure
    GP10099amyloid A protein fragment [Homo sapiens]
    Purity: >98%

    Apolipoproteins related to HDL in plasma

  • GP10118 structure
    GP10118Amyloid Beta-Peptide (1-40) (human)
    CAS: 131438-79-4
    Purity: >96.00%

    ببتيد أميلويد بيتا (1-40) (الإنسان)، (C194H295N53O58S1)، وهو ببتيد يحتوي على التسلسل H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH، الكتلة الجزيئية = 4329.8. يعد أميلويد بيتا (Aβ أو Abeta) من الببتيدات المكونة لـ 36-43 حمضًا أمينية والذي يُصَنَّع من بروتين مُستَخِرِج الأميلود.

  • GC10660 structure
    GC10660EHT 1864
    CAS: 754240-09-0
    Purity: >98.00%

    EHT 1864 هو مثبط لـ GTPases الصغيرة لعائلة Rac