LL-37 (trifluoroacetate salt) (Synonyms: CAP-18, hCAP-18, Cathelicidin, FALL-39) |
Catalog No.GC14377 |
LL-37 (sel de trifluoroacétate) est un peptide antimicrobien dérivé de cathélicidine, amphipathique et composé de 37 résidus, qui présente un large spectre d'activité antimicrobienne.
Products are for research use only. Not for human use. We do not sell to patients.
Cas No.: 154947-66-7
Sample solution is provided at 25 µL, 10mM.
Quality Control & SDS
- View current batch:
- Purity: >95.00%
- COA (Certificate Of Analysis)
- SDS (Safety Data Sheet)
- Datasheet
Cell experiment [1]: | |
Cell lines |
HaCaT cells |
Preparation Method |
HaCaT cells were transfected with a 2 μg of empty vector and 0.1, 0.5, 1, or 2 μg of LL-37 plasmids for 6 h and then internalized with P. gingivalis (MOI 100, 6 h) using the antibiotic protection assay. Total RNA was extracted after 18 h. |
Reaction Conditions |
0.1, 0.5, 1, or 2 μg; 6 h |
Applications |
The qRT-PCR results showed that compared with the control cells, the number of live P. gingivalis was significantly reduced by 0.79, 0.62, and 0.69 times in cells transfected with 0.5, 1, or 2 μg of LL 37 plasmids, respectively. LL 37 mRNA expression gradually increased significantly as transfected with 0.1, 0.5, or 1 μg of LL 37 plasmids, which was followed by a decrease and reached a peak in cells treated with 1 μg of LL 37 plasmids. |
Animal experiment [2]: | |
Animal models |
BALB/c female mice |
Preparation Method |
Mice were intravenously injected with PBS (200 μl) or LL 37 (3 μg/200 μl in PBS) just prior to CLP or sham operation. Peritoneal exudates (3 ml) and blood were collected 14–16 h after the operation, and the number of bacteria and inflammatory cells was determined. |
Dosage form |
3 μg/200 μl in PBS; i.v. |
Applications |
LL 37 administration significantly reduced the bacterial load in the peritoneal exudates (PBS-CLP vs LL-37-CLP) as well as blood. |
References: [1]. Yang X, et al. LL-37-Induced Autophagy Contributed to the Elimination of Live Porphyromonas gingivalis Internalized in Keratinocytes. Front Cell Infect Microbiol. 2020 Oct 15;10:561761. [2]. Kumagai Y, et al. Antimicrobial peptide LL-37 ameliorates a murine sepsis model via the induction of microvesicle release from neutrophils. Innate Immun. 2020 Oct;26(7):565-579. |
LL-37 contient 37 résidus d'acides aminés avec les deux premiers résidus de leucine (L1LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES37) et existe principalement dans les cellules épithéliales et les neutrophiles.
Une expérience in vitro a montré que le traitement avec 4 et 10 μM de LL-37 réduisait à la fois le nombre et la viabilité des cellules ostéoblastiques humaines MG63. Dans les mêmes conditions in vitro, le prétraitement des pMSCs avec 1 et 10 μg/mL de LL-37 n'a eu aucun effet sur leur capacité migratoire. Cependant, un prétraitement avec 1 μg/mL de LL-37 a augmenté leur potentiel migratoire après 48 heures. Une étude in vitro a indiqué qu'à une concentration de 1 µmol/L de LL-37 pendant 24 heures, celui-ci empêchait l'expression stimulée par LPS du MCP-1 analysée tant au niveau transcriptomique que protéique, mais n'avait aucun effet sur l'expression transcriptomique des récepteurs TLR2 et TLR4. En même temps, un traitement avec des concentrations de LL-37 à hauteur de 0,1 et 1 µmol/L pendant une durée d'une heure dans les cellules PDL induisait une immunoréactivité pour le peptide antimicrobien LL-37.
Une étude in vivo suggère que le traitement par 2 μg/souris de LL-37 par voie intraveineuse améliore la survie des souris septicémiques CLP avec un effet dose-dépendant. LL-37 améliore le niveau d'ectosomes ayant un potentiel antibactérien plus élevé, ce qui réduit la charge bactérienne chez les souris CLP.[1] La libération d'ectosomes à partir de neutrophiles est induite de manière dose-dépendante (1, 3 ou 10 μg/ml) par LL-37. L'injection de LL-37 supprime l'infiltration des cellules polymorphonucléaires chez les souris CLP, où la charge bactérienne et la réponse inflammatoire sont diminuées.[3]
References:
[1].Nagaoka I, et al. Therapeutic Potential of Cathelicidin Peptide LL-37, an Antimicrobial Agent, in a Murine Sepsis Model. Int J Mol Sci. 2020 Aug 19;21(17):5973.
[2].Bankell E, et al. LL-37-induced caspase-independent apoptosis is associated with plasma membrane permeabilization in human osteoblast-like cells. Peptides. 2021 Jan;135:170432.
[3].Kumagai Y, et al. Antimicrobial peptide LL-37 ameliorates a murine sepsis model via the induction of microvesicle release from neutrophils. Innate Immun. 2020 Oct;26(7):565-579.
[4].Oliveira-Bravo M, et al. LL-37 boosts immunosuppressive function of placenta-derived mesenchymal stromal cells. Stem Cell Res Ther. 2016 Dec 30;7(1):189.
[5].Aidoukovitch A, et al. The host defense peptide LL-37 is internalized by human periodontal ligament cells and prevents LPS-induced MCP-1 production. J Periodontal Res. 2019 Dec;54(6):662-670.
Cas No. | 154947-66-7 | SDF | |
Synonymes | CAP-18, hCAP-18, Cathelicidin, FALL-39 | ||
Canonical SMILES | CC[C@]([C@@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/C/N=C(O)/[C@](/N=C(O)/[C@](N)([H])CC(C)C)([H])CC(C)C)([H])CC(O)=O)([H])CC1=CC=CC=C1)([H])CC2=CC=CC=C2)([H])CCCNC(N)=N | ||
Formula | C205H340N60O53 | M.Wt | 4493.32 |
Solubility | Water: 1 mg/ml | Storage | Store at -20°C |
General tips | Please select the appropriate solvent to prepare the stock solution according to the
solubility of the product in different solvents; once the solution is prepared, please store it in
separate packages to avoid product failure caused by repeated freezing and thawing.Storage method
and period of the stock solution: When stored at -80°C, please use it within 6 months; when stored
at -20°C, please use it within 1 month. To increase solubility, heat the tube to 37°C and then oscillate in an ultrasonic bath for some time. |
||
Shipping Condition | Evaluation sample solution: shipped with blue ice. All other sizes available: with RT, or with Blue Ice upon request. |
Prepare stock solution | |||
1 mg | 5 mg | 10 mg | |
1 mM | 0.2226 mL | 1.1128 mL | 2.2255 mL |
5 mM | 0.0445 mL | 0.2226 mL | 0.4451 mL |
10 mM | 0.0223 mL | 0.1113 mL | 0.2226 mL |
Step 1: Enter information below (Recommended: An additional animal making an allowance for loss during the experiment)
Step 2: Enter the in vivo formulation (This is only the calculator, not formulation. Please contact us first if there is no in vivo formulation at the solubility Section.)
Calculation results:
Working concentration: mg/ml;
Method for preparing DMSO master liquid: mg drug pre-dissolved in μL DMSO ( Master liquid concentration mg/mL, Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug. )
Method for preparing in vivo formulation: Take μL DMSO master liquid, next addμL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O, mix and clarify.
Method for preparing in vivo formulation: Take μL DMSO master liquid, next add μL Corn oil, mix and clarify.
Note: 1. Please make sure the liquid is clear before adding the next solvent.
2. Be sure to add the solvent(s) in order. You must ensure that the solution obtained, in the previous addition, is a clear solution before proceeding to add the next solvent. Physical methods such as vortex, ultrasound or hot water bath can be used to aid dissolving.
3. All of the above co-solvents are available for purchase on the GlpBio website.
Average Rating: 5
(Based on Reviews and 1 reference(s) in Google Scholar.)GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *