NRG-1 protein, belonging to the structurally related peptide growth factor family of Human, originates from alternative splicing genes and induces Fn14 expression in MCF7 cells.
NRG1-beta 1 Protein, Human
Catalog No.: GC26535Purity:≥ 95% as determined by reducing SDS-PAGE
NRG-1 protein, belonging to the structurally related peptide growth factor family of Human, originates from alternative splicing genes and induces Fn14 expression in MCF7 cells.
Products are for research use only. Not for human use. We do not sell to patients.
2μgIn Stock
$39.00
1
10μgIn Stock
$108.00
1
50μgIn Stock
$225.00
1
100μgIn Stock
$360.00
1
| Pack Size | Price | Availability | Quantity | Action |
|---|---|---|---|---|
| 2μg | $39.00 | In Stock | 1 | |
| 10μg | $108.00 | In Stock | 1 | |
| 50μg | $225.00 | In Stock | 1 | |
| 100μg | $360.00 | In Stock | 1 |
Tel: (909) 407-4943 / (909) 689-7124Email: sales@glpbio.com
Citations
No citations are currently available for this product. Below are selected publications citing GlpBio products.
Nature641, 529–536 (2025)
Nature628, 630–638 (2024)
Nature632, 686–694 (2024)
Nature618, 1017–1023 (2023)
Nature610, 366–372 (2022)
Cell187(9):2288-2304 (2024)
Cell183(7):1867-1883 (2020)
Science388(6745) (2025)
Science387(6739) (2025)
Science387(6734) (2025)
Cell Research35, 97–116 (2025)
Cell Research34, 683–706 (2024)
Cell Research33, 273–287 (2023)
Cell Research33, 546–561 (2023)
Cell Research33, 904–922 (2023)
Cell Research31, 1291–1307 (2021)
Description
Product Documents
Purity:≥ 95% as determined by reducing SDS-PAGEAppearance:Lyophilized powder
Chemical Properties
Purity
≥ 95% as determined by reducing SDS-PAGE
Source
E. coli
Physical Appearance
Lyophilized powder
Shipping Condition
Room temperature in continental US; may vary elsewhere.
Synonyms
rHuHeregulin-1 β1; ARIA; HRG; NRG1; Neuregulin-1
Amino Acid Sequence
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE
Solubility
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Apparent Molecular Weight
Approximately 8 kDa Da
Biological Activity
Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 this effect is ≤ 2.158 ng/mL, corresponding to a specific activity is ≥ 4.6339×105 units/mg.
Formulation
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Reviews
Review for NRG1-beta 1 Protein, Human
Rating: 5
- 5 Star100%
- 4 Star0%
- 3 Star0%
- 2 Star0%
- 1 Star0%