>>Peptides>>LL-37 (trifluoroacetate salt)

LL-37 (trifluoroacetate salt) (Synonyms: CAP-18, hCAP-18, Cathelicidin, FALL-39)

Catalog No.GC14377

LL-37 (트리플루오로아세테이트 염)은 37개의 아미노산으로 이루어진 양성자 및 음성자를 모두 가지는 카텔리시딘 유래 항균 펩타이드로, 광범위한 항균 활동을 나타냅니다.

Products are for research use only. Not for human use. We do not sell to patients.

LL-37 (trifluoroacetate salt) Chemical Structure

Cas No.: 154947-66-7

Size 가격 재고 수량
1mg
US$88.00
재고 있음
5mg
US$182.00
재고 있음

Tel:(909) 407-4943 Email: sales@glpbio.com

고객 리뷰

Based on customer reviews.

  • GlpBio Citations

    GlpBio Citations
  • Bioactive Compounds Premium Provider

    Bioactive Compounds Premium Provider

Sample solution is provided at 25 µL, 10mM.

Product Documents

Quality Control & SDS

View current batch:

Protocol

Cell experiment [1]:

Cell lines

HaCaT cells

Preparation Method

HaCaT cells were transfected with a 2 μg of empty vector and 0.1, 0.5, 1, or 2 μg of LL-37 plasmids for 6 h and then internalized with P. gingivalis (MOI 100, 6 h) using the antibiotic protection assay. Total RNA was extracted after 18 h.

Reaction Conditions

0.1, 0.5, 1, or 2 μg; 6 h

Applications

The qRT-PCR results showed that compared with the control cells, the number of live P. gingivalis was significantly reduced by 0.79, 0.62, and 0.69 times in cells transfected with 0.5, 1, or 2 μg of LL 37 plasmids, respectively. LL 37 mRNA expression gradually increased significantly as transfected with 0.1, 0.5, or 1 μg of LL 37 plasmids, which was followed by a decrease and reached a peak in cells treated with 1 μg of LL 37 plasmids.

Animal experiment [2]:

Animal models

BALB/c female mice

Preparation Method

Mice were intravenously injected with PBS (200 μl) or LL 37 (3 μg/200 μl in PBS) just prior to CLP or sham operation. Peritoneal exudates (3 ml) and blood were collected 14–16 h after the operation, and the number of bacteria and inflammatory cells was determined.

Dosage form

3 μg/200 μl in PBS; i.v.

Applications

LL 37 administration significantly reduced the bacterial load in the peritoneal exudates (PBS-CLP vs LL-37-CLP) as well as blood.

References:

[1]. Yang X, et al. LL-37-Induced Autophagy Contributed to the Elimination of Live Porphyromonas gingivalis Internalized in Keratinocytes. Front Cell Infect Microbiol. 2020 Oct 15;10:561761.

[2]. Kumagai Y, et al. Antimicrobial peptide LL-37 ameliorates a murine sepsis model via the induction of microvesicle release from neutrophils. Innate Immun. 2020 Oct;26(7):565-579.

Background

LL-37는 37개의 아미노산 잔여물을 포함하며 첫 번째 두 개의 로이신 잔기 (L1LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES37)를 가지고 있으며 대부분 상피 세포와 중성구에 존재합니다.

체외 실험에서는 4 및 10 μM의 LL-37 처리가 인간 골모양 MG63 세포의 수와 생존율을 감소시켰음이 보여졌습니다. 체외에서 pMSCs를 1 및 10 μg/mL의 LL-37로 예처리한 경우 이동세포 능력에 영향을 미치지 않았으나, 1 μg/mL의 LL-37로 예처리 한 경우, pMSCs의 이동 잠재력이 48 시간 후에 증가되었습니다. 체외 연구에서는 LPS 유도 MCP-1 발현을 억제하는 것으로 나타났으며, 특정한 TLR2 및 TLR4 전사 발현에는 영향을 주지 않았습니다. 동시에 PDL 세포에서는 0.1 및 1 µmol/L LL-37 처리가 면역 반응성을 유발하였습니다.

체내 연구에서는 2 μg/마우스의 LL-37 정맥 주사 치료가 용량 의존적인 효과로 CLP 패혈증 마우스의 생존율을 개선시키는 것으로 나타났습니다. LL-37은 항균 작용이 더 강한 이크토좀 수준을 개선하여, CLP 마우스의 박테리아 부하를 줄이는 결과를 가져왔습니다.[1] LL-37은 용량 의존적으로 (1, 3 또는 10 μg/ml) 중성골수세포에서 이크토좀 방출을 유도합니다. LL-37 주입은 박테리아 부하와 염증 반응이 감소하는 곳에서 CLP 마우스의 다핵구 세포 침습을 억제합니다.[3]

References:
[1].Nagaoka I, et al. Therapeutic Potential of Cathelicidin Peptide LL-37, an Antimicrobial Agent, in a Murine Sepsis Model. Int J Mol Sci. 2020 Aug 19;21(17):5973.
[2].Bankell E, et al. LL-37-induced caspase-independent apoptosis is associated with plasma membrane permeabilization in human osteoblast-like cells. Peptides. 2021 Jan;135:170432.
[3].Kumagai Y, et al. Antimicrobial peptide LL-37 ameliorates a murine sepsis model via the induction of microvesicle release from neutrophils. Innate Immun. 2020 Oct;26(7):565-579.
[4].Oliveira-Bravo M, et al. LL-37 boosts immunosuppressive function of placenta-derived mesenchymal stromal cells. Stem Cell Res Ther. 2016 Dec 30;7(1):189.
[5].Aidoukovitch A, et al. The host defense peptide LL-37 is internalized by human periodontal ligament cells and prevents LPS-induced MCP-1 production. J Periodontal Res. 2019 Dec;54(6):662-670.

Chemical Properties

Cas No. 154947-66-7 SDF
Synonyms CAP-18, hCAP-18, Cathelicidin, FALL-39
Canonical SMILES CC[C@]([C@@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/C/N=C(O)/[C@](/N=C(O)/[C@](N)([H])CC(C)C)([H])CC(C)C)([H])CC(O)=O)([H])CC1=CC=CC=C1)([H])CC2=CC=CC=C2)([H])CCCNC(N)=N
Formula C205H340N60O53 M.Wt 4493.32
Solubility Water: 1 mg/ml Storage Store at -20°C
General tips Please select the appropriate solvent to prepare the stock solution according to the solubility of the product in different solvents; once the solution is prepared, please store it in separate packages to avoid product failure caused by repeated freezing and thawing.Storage method and period of the stock solution: When stored at -80°C, please use it within 6 months; when stored at -20°C, please use it within 1 month.
To increase solubility, heat the tube to 37°C and then oscillate in an ultrasonic bath for some time.
Shipping Condition Evaluation sample solution: shipped with blue ice. All other sizes available: with RT, or with Blue Ice upon request.

Complete Stock Solution Preparation Table

Prepare stock solution
1 mg 5 mg 10 mg
1 mM 0.2226 mL 1.1128 mL 2.2255 mL
5 mM 0.0445 mL 0.2226 mL 0.4451 mL
10 mM 0.0223 mL 0.1113 mL 0.2226 mL
  • Molarity Calculator

  • Dilution Calculator

Mass
=
Concentration
x
Volume
x
MW*
 
 
 
**When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and MSDS / CoA (available online).

Calculate

In vivo Formulation Calculator (Clear solution)

Step 1: Enter information below (Recommended: An additional animal making an allowance for loss during the experiment)

mg/kg g μL

Step 2: Enter the in vivo formulation (This is only the calculator, not formulation. Please contact us first if there is no in vivo formulation at the solubility Section.)

% DMSO % % Tween 80 % ddH2O
%DMSO %

Calculation results:

Working concentration: mg/ml;

Method for preparing DMSO master liquid: mg drug pre-dissolved in μL DMSO ( Master liquid concentration mg/mL, Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug. )

Method for preparing in vivo formulation: Take μL DMSO master liquid, next addμL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O, mix and clarify.

Method for preparing in vivo formulation: Take μL DMSO master liquid, next add μL Corn oil, mix and clarify.

Note: 1. Please make sure the liquid is clear before adding the next solvent.
2. Be sure to add the solvent(s) in order. You must ensure that the solution obtained, in the previous addition, is a clear solution before proceeding to add the next solvent. Physical methods such as vortex, ultrasound or hot water bath can be used to aid dissolving.
3. All of the above co-solvents are available for purchase on the GlpBio website.

리뷰

Review for LL-37 (trifluoroacetate salt)

Average Rating: 5 ★★★★★ (Based on Reviews and 1 reference(s) in Google Scholar.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%
Review for LL-37 (trifluoroacetate salt)

GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.

Required fields are marked with *

You may receive emails regarding this submission. Any emails will include the ability to opt-out of future communications.