GLPBio

Glucagon Receptor

Glucagon receptor is a member of the class B G-protein coupled family of receptors and is activated by glucagon, resulting in activation of adenylate cyclase and increased levels of intracellular cAMP.

Products Related to Glucagon Receptor(54)

  • GC31363 structure
    GC31363GLP-1 receptor agonist 1
    CAS: 2212020-52-3
    Purity: >99.00%

    GLP-1-Rezeptoragonist 1 (GLP-1-Rezeptoragonist 1) ist ein GLP-1-Rezeptoragonist, der aus dem Patent WO2018056453A1, Verbindung 67, extrahiert wurde.

  • GC31379 structure
    GC31379GRA Ex-25
    CAS: 307983-31-9
    Purity: >98.00%

    GRA Ex-25 ist ein wirksamer Glucagon-Rezeptor-Inhibitor mit IC 50 -Werten von 56nm und 55nM für den Ratten-Glucagon-Rezeptor bzw. den menschlichen Glucagon-Rezeptor.

  • GC31404 structure
    GC31404Semaglutide
    CAS: 910463-68-2
    Purity: >98.00%

    Semaglutide ist ein langwirksames Analogon vom humanen Glukagon-ähnlichen Peptid-1(GLP-1) und ein Agonist des humanen GLP-1-Rezeptors.

  • GC31416 structure
    GC31416HAEGTFTSDVS
    CAS: 864915-61-7
    Purity: >98.00%

    HAEGTFTSDVS sind die ersten N-terminalen Reste 1-11 des GLP-1-Peptids.

  • GC31436 structure
    GC31436HAEGTFTSD
    CAS: 926018-45-3
    Purity: >98.00%

    HAEGTFTSD ist ein 9-Rest-Peptid des humanen GLP-1-Peptids oder GLP-1(7-36)-Amids.

  • GC33759 structure
    GC33759GLP-1(7-36) Acetate (Human GLP-1-(7-36)-amide Acetate)
    CAS: 1119517-19-9
    Purity: >98.00%

    GLP-1(7-36)-Acetat (Humanes GLP-1-(7-36)-Amidacetat) ist ein wichtiges Darmhormon, das die Glucose-induzierte Insulinsekretion von β stimuliert; Zellen.

  • GC34244 structure
    GC34244GLP-1 moiety from Dulaglutide
    CAS: 1197810-60-8
    Purity: >98%

    Die GLP-1-Einheit von Dulaglutid ist ein 31-AminosÄuren-Fragment von Dulaglutid, einem Glucagon-like-Peptid-1-Rezeptor (GLP-1)-Agonisten, extrahiert aus dem Patent US 20160369010 A1.

  • GC34245 structure
    GC34245GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
    Purity: >99.00%

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS ist ein Exendin-4-Peptid-Derivat.

  • GC34246 structure
    GC34246FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
    Purity: >98.00%

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS ist ein Exendin-4-Peptidderivat.

  • GC34249 structure
    GC34249KQMEEEAVRLFIEWLKNGGPSSGAPPPS
    Purity: >98%
  • GC34328 structure
    GC34328Semaglutide TFA
    Purity: >98.00%

    Semaglutid TFA, ein langwirksames GLP-1-Analogon, ist ein Agonist des Glucagon-ähnlichen Peptids-1 (GLP-1)-Rezeptors.

  • GC34904 structure
    GC34904GLP-1(7-37) acetate
    CAS: 1450806-98-0
    Purity: >98.50%

    GLP-1(7-37)-Acetat ist ein intestinales insulinotropes Hormon, das die durch Glukose induzierte Insulinsekretion erhÖht.

  • GC36147 structure
    GC36147GLP-1 receptor agonist 2
    CAS: 2230197-64-3
    Purity: >99.00%

    GLP-1-Rezeptoragonist 2 ist ein Glucagon-like-Peptid-1-Rezeptor (GLP-1R)-Agonist.

  • GC36148 structure
    GC36148GLP-1R Antagonist 1
    CAS: 488097-06-9
    Purity: >99.50%

    GLP-1R-Antagonist 1 (Verbindung 5d) ist ein oral aktiver, ZNS-penetrierender und nicht kompetitiver Antagonist des Glucagon-like-Peptid-1-Rezeptors (GLP-1R) mit einem IC50 von 650 nM.

  • GC36150 structure
    GC36150Glucagon-Like Peptide (GLP) I (7-36), amide, human
    CAS: 107444-51-9
    Purity: >98%

    Glucagon-Like Peptide (GLP) I (7-36), Amid, human, ist ein physiologisches Inkretinhormon, das die Insulinsekretion stimuliert.

  • GC36152 structure
    GC36152Glucagon-like peptide 1 (1-37), human (TFA)
    Purity: >98%
  • GC36753 structure
    GC36753NNC-0640
    CAS: 307986-98-7
    Purity: >98.00%

    NNC-0640 ist ein potenter humaner G-Protein-gekoppelter Glucagonrezeptor (GCGR) negativer allosterischer Modulator (NAM) mit einem IC50 von 69,2 nM.

  • GC37929 structure
    GC37929VU0453379
    CAS: 1638646-27-1
    Purity: >98%

    VU0453379 ist ein hochselektiver und fÜr das Zentralnervensystem (ZNS) penetranter positiver allosterischer Modulator (PAM) des Glucagon-like Peptide-1R (GLP-1R) mit einem EC50 von 1,3 μM.

  • GC38495 structure
    GC38495Secretin (33-59), rat TFA
    Purity: >98%

    Sekretin (33-59), Ratte (TFA) ist ein Peptid mit 27 AminosÄuren, das auf den Sekretinrezeptor einwirkt und die Sekretion von Bicarbonat, Enzymen und K+ aus der BauchspeicheldrÜse verstÄrkt.

  • GC38832 structure
    GC38832PF-06882961
    CAS: 2230198-02-2
    Purity: >97.00%

    PF-06882961 ist ein potenter, oral verfügbarer Agonist des Glucagon-ähnlichen Peptid-1-Rezeptors (GLP-1R).

  • GC39323 structure
    GC39323{Val1}-Exendin-3/4
    Purity: >99.00%

    {Val1}-Exendin-3/4 sind die ersten N-terminalen 1-28 Reste des Exendin-4-Peptids.

  • GC39364 structure
    GC39364Cotadutide acetate
    Purity: >98.00%

    Cotadutid (MEDI0382) Acetat ist ein potenter Dualagonist von Glucagon-ähnlichem Peptid-1 (GLP-1) und GCGR mit EC50-Werten von 6,9 pM bzw. 10,2 pM.

  • GC43644 structure
    GC43644Exendin-4 (acetate)
    CAS: 914454-01-6
    Purity: >99.00%

    Exendin-4 (Acetat) (Exenatide-Acetat), ein Peptid mit 39 Aminosäuren, ist ein Glucagon-ähnlicher Peptid-1-Rezeptoragonist mit Langzeitwirkung und einem IC50-Wert von 3,22 nM.

  • GC43761 structure
    GC43761GLP-1 (1-37) (human, rat, mouse, bovine) (trifluoroacetate salt)
    CAS: 87805-34-3
    Purity: >98.00%

    GLP-1 (1-37) (Mensch, Ratte, Maus, Rind) (Trifluoracetatsalz) ist ein hochpotenter Agonist des GLP-1-Rezeptors.