Search Site
  • 0
    Mein Warenkorb

    Hier klicken, um die Anzahl der von Ihnen hinzugefügten Artikel zu sehen:)

    image loader

    Artikel in den Warenkorb legen......

Startseite >> Signaling Pathways >> GPCR/G protein >> Glucagon Receptor

Glucagon Receptor

Glucagon receptor is a member of the class B G-protein coupled family of receptors and is activated by glucagon, resulting in activation of adenylate cyclase and increased levels of intracellular cAMP.

Produkte für  Glucagon Receptor

  1. Bestell-Nr. Artikelname Informationen
  2. GC31322 Adomeglivant (LY2409021)

    LY2409021

     Adomeglivant (LY2409021) (LY2409021) ist ein potenter, selektiver allosterischer Antagonist des Glucagonrezeptors (GluR). Adomeglivant (LY2409021) Chemical Structure
  3. GC25046 Albiglutide Fragment Albiglutide fragment is one copy of a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36). Albiglutide Fragment Chemical Structure
  4. GC16232 BETP BETP ist ein Agonist des Glucagon-like Peptide-1 (GLP-1)-Rezeptors mit EC50-Werten von 0,66 bzw. 0,755 μM fÜr den GLP-1-Rezeptor von Mensch und Ratte. BETP Chemical Structure
  5. GC39364 Cotadutide acetate

    MEDI0382 acetate

    Cotadutid (MEDI0382) Acetat ist ein potenter Dualagonist von Glucagon-ähnlichem Peptid-1 (GLP-1) und GCGR mit EC50-Werten von 6,9 pM bzw. 10,2 pM.

     Cotadutide acetate Chemical Structure
  6. GC11646 des-His1-[Glu9]-Glucagon (1-29) amide des-His1-[Glu9]-Glucagon (1-29) Amid ist ein potenter Peptidantagonist des Glukagonrezeptors mit einem pA2 von 7,2. des-His1-[Glu9]-Glucagon (1-29) amide Chemical Structure
  7. GC16482 Exendin-3 (9-39) amide

    Avexitide;Exendin (9-39)

     Exendin-3 (9-39) amide ist ein spezifischer Exendin-Rezeptor-Antagonist. Exendin-3 erhöhte die zellulären cAMP-Spiegel und die Amylasefreisetzung aus dispergierten Azini der Meerschweinchen-Bauchspeicheldrüse. Exendin-3 (9-39) amide Chemical Structure
  8. GC60829 Exendin-3/4 (59-86) Exendin-3/4 (59-86) ist ein Exendin-4-Peptidderivat. Exendin-3/4 (59-86) Chemical Structure
  9. GC13391 Exendin-4 Exendin-4 ist ein 39-Aminosäure-Polypeptid (48-86) und ein langwirksamer Agonist des Glucagon-Like Peptids-1 (GLP-1)-Rezeptors mit einem IC50 von 3,22 nM. Exendin-4 Chemical Structure
  10. GC43644 Exendin-4 (acetate)

    Exenatide Acetate

     Exendin-4 (Acetat) (Exenatide-Acetat), ein Peptid mit 39 Aminosäuren, ist ein Glucagon-ähnlicher Peptid-1-Rezeptoragonist mit Langzeitwirkung und einem IC50-Wert von 3,22 nM. Exendin-4 (acetate) Chemical Structure
  11. GC34246 FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS ist ein Exendin-4-Peptidderivat. FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Chemical Structure
  12. GC43761 GLP-1 (1-37) (human, rat, mouse, bovine) (trifluoroacetate salt)

    Glucagon-like Peptide-1

     GLP-1 (1-37) (Mensch, Ratte, Maus, Rind) (Trifluoracetatsalz) ist ein hochpotenter Agonist des GLP-1-Rezeptors. GLP-1 (1-37) (human, rat, mouse, bovine) (trifluoroacetate salt) Chemical Structure
  13. GC13743 GLP-1 (9-36) amide GLP-1 (9-36)-Amid ist ein Hauptmetabolit des Glucagon-ähnlichen Peptid-1-(7-36)-Amids, das durch das Enzym Dipeptidylpeptidase-4 (DPP-4) gebildet wird. GLP-1 (9-36) amide Chemical Structure
  14. GC34244 GLP-1 moiety from Dulaglutide Die GLP-1-Einheit von Dulaglutid ist ein 31-AminosÄuren-Fragment von Dulaglutid, einem Glucagon-like-Peptid-1-Rezeptor (GLP-1)-Agonisten, extrahiert aus dem Patent US 20160369010 A1. GLP-1 moiety from Dulaglutide Chemical Structure
  15. GC31363 GLP-1 receptor agonist 1

    LY3502970

     GLP-1-Rezeptoragonist 1 (GLP-1-Rezeptoragonist 1) ist ein GLP-1-Rezeptoragonist, der aus dem Patent WO2018056453A1, Verbindung 67, extrahiert wurde. GLP-1 receptor agonist 1 Chemical Structure
  16. GC36147 GLP-1 receptor agonist 2 GLP-1-Rezeptoragonist 2 ist ein Glucagon-like-Peptid-1-Rezeptor (GLP-1R)-Agonist. GLP-1 receptor agonist 2 Chemical Structure
  17. GC61545 GLP-1(28-36)amide GLP-1(28-36)amid, ein C-terminales Nonapeptid von GLP-1, ist ein Hauptprodukt, das aus der Spaltung von GLP-1 durch die neutrale Endopeptidase (NEP) stammt. GLP-1(28-36)amide Chemical Structure
  18. GC61540 GLP-1(32-36)amide GLP-1(32-36)amid, ein Pentapeptid, abgeleitet vom C-Terminus des glukoregulatorischen Hormons GLP-1. GLP-1(32-36)amide Chemical Structure
  19. GC33759 GLP-1(7-36) Acetate (Human GLP-1-(7-36)-amide Acetate)

    Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate; Human GLP-1 (7-36), amide acetate

     GLP-1(7-36)-Acetat (Humanes GLP-1-(7-36)-Amidacetat) ist ein wichtiges Darmhormon, das die Glucose-induzierte Insulinsekretion von β stimuliert; Zellen. GLP-1(7-36) Acetate (Human GLP-1-(7-36)-amide Acetate) Chemical Structure
  20. GC60876 GLP-1(7-36), amide TFA

    Glucagon-like peptide-1 (GLP-1)(7-36), amide TFA; Human GLP-1 (7-36), amide TFA

     GLP-1(7-36), Amid TFA ist ein wichtiges Darmhormon, das die Glucose-induzierte Insulinsekretion aus β-Zellen stimuliert. GLP-1(7-36), amide TFA Chemical Structure
  21. GC30058 GLP-1(7-37) GLP-1(7-37) ist ein intestinales insulinotropes Hormon, das die durch Glukose induzierte Insulinsekretion verstÄrkt. GLP-1(7-37) Chemical Structure
  22. GC34904 GLP-1(7-37) acetate GLP-1(7-37)-Acetat ist ein intestinales insulinotropes Hormon, das die durch Glukose induzierte Insulinsekretion erhÖht. GLP-1(7-37) acetate Chemical Structure
  23. GC36148 GLP-1R Antagonist 1 GLP-1R-Antagonist 1 (Verbindung 5d) ist ein oral aktiver, ZNS-penetrierender und nicht kompetitiver Antagonist des Glucagon-like-Peptid-1-Rezeptors (GLP-1R) mit einem IC50 von 650 nM. GLP-1R Antagonist 1 Chemical Structure
  24. GC13075 GLP-2 (rat) GLP-2 (Ratte) ist ein intestinaler Wachstumsfaktor. GLP-2 (rat) Chemical Structure
  25. GC16646 GLP-2(1-33) (human) GLP-2(1-33) (Mensch) ist ein enteroendokrines Hormon, das an den GLP-2-Rezeptor binden und das Wachstum des Darmepithels stimulieren kann. GLP-2(1-33) (human) Chemical Structure
  26. GC60877 GLP-2(3-33) GLP-2(3-33), natÜrlich erzeugt durch Dipeptidylpeptidase IV (DPPIV), wirkt als partieller Agonist auf den GLP-2-Rezeptor (EC50=5,8 nM). GLP-2(3-33) Chemical Structure
  27. GC15486 glucagon receptor antagonists 1 glucagon receptor antagonists 1 Chemical Structure
  28. GC12569 glucagon receptor antagonists 2 glucagon receptor antagonists 2 Chemical Structure
  29. GC13512 glucagon receptor antagonists 3 glucagon receptor antagonists 3 Chemical Structure
  30. GC19170 Glucagon receptor antagonists-4

    GCGR Antagonist IV

     Glucagon-Rezeptor-Antagonisten-4 ist ein hochwirksamer, nicht-peptidischer und oral aktiver Glucagon-Rezeptor-Antagonist. Glucagon receptor antagonists-4 Chemical Structure
  31. GC36150 Glucagon-Like Peptide (GLP) I (7-36), amide, human Glucagon-Like Peptide (GLP) I (7-36), Amid, human, ist ein physiologisches Inkretinhormon, das die Insulinsekretion stimuliert. Glucagon-Like Peptide (GLP) I (7-36), amide, human Chemical Structure
  32. GC36152 Glucagon-like peptide 1 (1-37), human (TFA)

    HuGLP-1 TFA

     Glucagon-like peptide 1 (1-37), human (TFA) Chemical Structure
  33. GC31379 GRA Ex-25 GRA Ex-25 ist ein Inhibitor des Glukagonrezeptors mit IC50 von 56 bzw. 55 nM fÜr Ratten- bzw. Human-Glukagonrezeptoren. GRA Ex-25 Chemical Structure
  34. GC34245 GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS ist ein Exendin-4-Peptid-Derivat. GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Chemical Structure
  35. GC30254 HAEGTFT HAEGTFT sind die ersten N-terminalen Reste 1-7 des GLP-1-Peptids. HAEGTFT Chemical Structure
  36. GC31436 HAEGTFTSD HAEGTFTSD ist ein 9-Rest-Peptid des humanen GLP-1-Peptids oder GLP-1(7-36)-Amids. HAEGTFTSD Chemical Structure
  37. GC31416 HAEGTFTSDVS HAEGTFTSDVS sind die ersten N-terminalen Reste 1-11 des GLP-1-Peptids. HAEGTFTSDVS Chemical Structure
  38. GC34249 KQMEEEAVRLFIEWLKNGGPSSGAPPPS KQMEEEAVRLFIEWLKNGGPSSGAPPPS Chemical Structure
  39. GC17298 L-168,049 L-168.049 ist ein potenter, selektiver, oral aktiver und nicht kompetitiver Glucagonrezeptorantagonist mit IC50-Werten von 3,7 nM, 63 nM und 60 nM für menschliche, murine bzw. kanine Glucagonrezeptoren. L-168,049 Chemical Structure
  40. GC31343 LGD-6972 LGD-6972 ist ein selektiver und oral wirksamer Glucagonrezeptorantagonist. LGD-6972 Chemical Structure
  41. GC10311 Liraglutide

    HAEGTFTSDVSSYL-{N6-[N-(1-oxohexadecyl)-L-γ-Etamyl]-Glu}-GQAAKEFIAWLVRGRG

     Liraglutide ist ein hochwirksamer, langwirkender GLP-1-Rezeptoragonist (EC50 = 61 pM) und teilt 97 % seiner Aminosäuresequenzidentität mit humanem GLP-1. Liraglutide Chemical Structure
  42. GC31334 Lixisenatide Lixisenatid ist ein Glucagon-like Peptide-1 (GLP-1)-Rezeptoragonist, der zur Behandlung von Typ-2-Diabetes mellitus (T2DM) eingesetzt werden kann. Lixisenatide Chemical Structure
  43. GC10075 Methylprednisolone Sodium Succinate

    glucocorticoid

     Methylprednisolone Sodium Succinate Chemical Structure
  44. GC14793 MK 0893 MK 0893 ist ein potenter und selektiver Glucagon-Rezeptor (GCGR-Antragonist mit einem IC50-Wert von 6.6 nM. MK 0893 Chemical Structure
  45. GC36753 NNC-0640 NNC-0640 ist ein potenter humaner G-Protein-gekoppelter Glucagonrezeptor (GCGR) negativer allosterischer Modulator (NAM) mit einem IC50 von 69,2 nM. NNC-0640 Chemical Structure
  46. GC16969 Oxyntomodulin Oxyntomodulin, ein Peptidhormon aus 37 AminosÄuren, ist ein Glucagon-like Peptide 1 (GLP-1)-Rezeptoragonist. Oxyntomodulin Chemical Structure
  47. GC38832 PF-06882961

    PF-06882961 ist ein potenter, oral verfügbarer Agonist des Glucagon-ähnlichen Peptid-1-Rezeptors (GLP-1R).

     PF-06882961 Chemical Structure
  48. GC38495 Secretin (33-59), rat TFA

    Secretin (rat) (TFA)

     Sekretin (33-59), Ratte (TFA) ist ein Peptid mit 27 AminosÄuren, das auf den Sekretinrezeptor einwirkt und die Sekretion von Bicarbonat, Enzymen und K+ aus der BauchspeicheldrÜse verstÄrkt. Secretin (33-59), rat TFA Chemical Structure
  49. GC31404 Semaglutide

    Semaglutid, ein langwirksames GLP-1-Analogon, ist ein Agonist des Glucagon-ähnlichen Peptids-1 (GLP-1)-Rezeptors.

     Semaglutide Chemical Structure
  50. GC34328 Semaglutide TFA

    Semaglutid TFA, ein langwirksames GLP-1-Analogon, ist ein Agonist des Glucagon-ähnlichen Peptids-1 (GLP-1)-Rezeptors.

     Semaglutide TFA Chemical Structure
  51. GC31360 Taspoglutide (ITM077) Taspoglutid (ITM077) ist ein langwirksamer Glucagon-like Peptide 1 (GLP-1)-Rezeptoragonist, der zur Behandlung von Typ-2-Diabetes entwickelt wurde und einen EC50-Wert von 0,06 nM hat. Taspoglutide (ITM077) Chemical Structure
  52. GC26027 V-0219 V-0219 is an orally active, positive allosteric modulator (PAM) of the glucagon-like peptide-1 receptor (GLP-1R), can be used for obesity-associated diabetes research. V-0219 Chemical Structure
  53. GC37929 VU0453379 VU0453379 ist ein hochselektiver und fÜr das Zentralnervensystem (ZNS) penetranter positiver allosterischer Modulator (PAM) des Glucagon-like Peptide-1R (GLP-1R) mit einem EC50 von 1,3 μM. VU0453379 Chemical Structure
  54. GC62753 [Des-His1,Glu9]-Glucagon amide TFA [Des-His1,Glu9]-Glucagonamid TFA ist ein potenter Peptidantagonist des Glukagonrezeptors mit einem pA2 von 7,2. [Des-His1,Glu9]-Glucagon amide TFA Chemical Structure
  55. GC39323 {Val1}-Exendin-3/4 {Val1}-Exendin-3/4 sind die ersten N-terminalen 1-28 Reste des Exendin-4-Peptids. {Val1}-Exendin-3/4 Chemical Structure

54 Artikel

pro Seite

Absteigend sortieren