GLPBio

Amyloid β

Amyloid β denotes peptides of 36–43 amino acids result from the APP (amyloid precursor protein) and are involved in Alzheimer's disease as the main component of the amyloid plaques.

Products Related to Amyloid β(118)

  • GC68725 structure
    GC68725Bapineuzumab
    CAS: 648895-38-9
    Purity: >96.00%

    Bapineuzumab is a monoclonal antibody against β-amyloid protein (APP). Bapineuzumab can be used for research on Alzheimer's disease (AD).

  • GC68996 structure
    GC68996Donanemab
    CAS: 1931944-80-7
    Purity: >97.00%

    Donanemab ist ein humanisierter monoklonaler IgG1-Antikörper. Donanemab bindet an abgelagertes Aβ42 und beseitigt Amyloid-Plaques im Gehirn durch Mikroglia-vermittelte Phagocytose. Donanemab reichert hauptsächlich im Plasma und im extrazellulären Raum an und dringt durch die Blut-Hirn-Schranke ins Gehirn ein, um an Aβ-Ablagerungen zu binden. Donanemab ist eine wirksame Behandlungsmethode für die Alzheimer-Krankheit.

  • GC69150 structure
    GC69150Gantenerumab
    CAS: 1043556-46-2
    Purity: 98.50%

    Gantenerumab is a fully human anti-amyloid-beta (Aβ) IgG1 monoclonal antibody that demonstrates sustained binding to brain amyloid-beta. Gantenerumab can be used for Alzheimer's disease research.

  • GC70182 structure
    GC70182β-Amyloid (1-40), FAM-labeled TFA
    Purity: >99.00%

    β-Amyloid (1-40), FAM-markiert TFA ist ein mit FAM markiertes fluoreszierendes Peptid von β-Amyloid (1-40) (Λex= 492 nm und Λem= 518 nm).

  • GN10307 structure
    GN10307Ginsenoside Re
    CAS: 52286-59-6
    Purity: >99.00%

    Ginsenoside Re is a natural compound found in Panax ginseng , possessing potent antioxidant and anti-inflammatory bioactivities.

  • GN10313 structure
    GN10313Schisantherin B
    CAS: 58546-55-7
    Purity: >99.50%
  • GN10428 structure
    GN10428Geniposide
    CAS: 24512-63-8
    Purity: >99.50%
  • GN10502 structure
    GN10502Saikosaponin C
    CAS: 20736-08-7
    Purity: >98.00%
  • GN10544 structure
    GN10544Ginsenoside Rg1
    CAS: 22427-39-0
    Purity: >98.00%

    Ginsenoside Rg1 ist einer der Hauptwirkstoffe aus Panax ginseng. Es gehört zu den Steroid-Glykosid und hat viele verschiedene biologische Aktivitäten.

  • GN10614 structure
    GN10614Ginsenoside Rg2
    CAS: 52286-74-5
    Purity: >98.00%
  • GN10695 structure
    GN10695Notoginsenoside R1
    CAS: 80418-24-2
    Purity: >98.00%

    Notoginsenoside R1 is a major active saponin component isolated from Panax notoginseng and is a key bioactive compound in many traditional Chinese medicine formulations.

  • GN10799 structure
    GN1079920(S)-Ginsenoside Rg3
    CAS: 14197-60-5
    Purity: >98.00%

    20(S)-Ginsenoside Rg3 is a rare ginsenoside extracted from ginseng (Na + : IC 50 = 32.2±4.5μM; hKv1.4: IC 50 = 32.6±2.2μM).

  • GP10046 structure
    GP10046Amyloid Precursor C-Terminal Peptide
    Purity: >98%

    For beta amyloid generation

  • GP10049 structure
    GP10049Amyloid Beta-Peptide (12-28) (human)
    CAS: 107015-83-8
    Purity: >95.00%

    Amyloid Beta-Peptide (12-28) (human) ist ein Peptidfragment des Amyloid-Beta-Proteins(1-42) (Aβ (1-42)).

  • GP10057 structure
    GP10057Amyloid β-Peptide (10-20) (human)
    CAS: 152286-31-2
    Purity: >98%
  • GP10082 structure
    GP10082Amyloid Beta-peptide (25-35) (human)
    CAS: 131602-53-4
    Purity: >98.50%

    Amyloid Beta-peptide (25-35) (human) ist ein Fragment des Alzheimer-Amyloid-beta-Peptid, das oft im Gehirn von Menschen mit Alzheimer-Krankheit(AD) vorkommt und ein Hauptbestandteil von Alzheimer-Senile Plaques ist.

  • GP10083 structure
    GP10083Beta-Amyloid (1-11)
    CAS: 190436-05-6
    Purity: >98%
  • GP10094 structure
    GP10094Amyloid β-peptide (10-35), amide
    Purity: >98%
  • GP10097 structure
    GP10097Amyloid β-Protein (1-15)
    CAS: 183745-81-5
    Purity: >98%
  • GP10099 structure
    GP10099amyloid A protein fragment [Homo sapiens]
    Purity: >98%

    Apolipoproteins related to HDL in plasma

  • GP10118 structure
    GP10118Amyloid Beta-Peptide (1-40) (human)
    CAS: 131438-79-4
    Purity: >96.00%

    Amyloid β-Peptid (1-40) (human), (C194H295N53O58S1), ist ein Peptid mit der Sequenz H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid-Beta (Aβ oder Abeta) ist ein Peptid von 36–43 Aminosäuren, das aus dem Amyloid-Vorläuferprotein verarbeitet wird.

  • GC10660 structure
    GC10660EHT 1864
    CAS: 754240-09-0
    Purity: >98.00%

    EHT 1864 ist ein Inhibitor der kleinen GTPasen der Rac-Familie.