Peptides
Research Areas
Products Related to Peptides(2445)
- GC91864CXCL9 (74-103) (human) (trifluoroacetate salt)Purity: >98.00%
Chemokine (C-X-C motif) ligand 9 (CXCL9) (74-103) is a C-terminal fragment of mature CXCL9.
- GC91865WaTx (36-68) (scorpion) (trifluoroacetate salt)Purity: >95.00%
Wasabi receptor toxin (WaTx) (36-68) is a cell-penetrating peptide that corresponds to the mature toxin sequence and is an activator of transient receptor potential ankyrin 1 (TRPA1).
- GC91866Apelin-36 (trifluoroacetate salt)Purity: >95.00%
The apelin gene encodes a preproprotein that is processed to generate a variety of bioactive peptides, including those having 36, 17, or 13 amino acids (apelin-36, apelin-17, and apelin-13, respectively).
- GC91867SNX-482 (ammonium salt)Purity: >95.00%
SNX-482 is a peptide originally isolated from H. gigas venom that acts as a class E/R-type voltage-sensitive calcium channel blocker (IC50 = 30 nM in 192C cells expressing human class E channels).
- GC91868Glucose-dependent Insulinotropic Polypeptide (1-39) (porcine) (trifluoroacetate salt)Purity: >98.00%
Glucose-dependent Insulinotropic Polypeptide (GIP) (1-39) is an endogenous 39-amino acid peptide hormone that induces insulin secretion.
- GC91869Retatrutide (sodium salt)Purity: >98.00%
Retatrutide is a triple agonist of the glucagon receptor (GCGR), glucagon-like peptide 1 receptor (GLP-1R), and gastric inhibitory polypeptide receptor (GIP receptor), also known as the glucose-dependent insulinotropic polypeptide receptor.
- GC91870Glucose-dependent Insulinotropic Polypeptide (3-42) (human) (trifluoroacetate salt)Purity: >90.00%
Gastric inhibitory peptide 1 (GIP-1) (3-42) is a peptide fragment of the incretin hormone GIP and a GIP receptor antagonist.
- GC92124FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt)Purity: >95.00%
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt)은 내인성 인크레틴 호르몬 글루카곤 유사 펩타이드 1 (GLP-1)의 유도체이다.
- GC92126GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt)Purity: >95.00%
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt) 는 펩타이드의 일종이다.
- GP10023Angiotensin IICAS: 4474-91-3Purity: >99.50%
Angiotensin II는 레닌-안지오텐신 시스템 (RAS)의 주요 이펙터 펩타이드이다.
- GP10049Amyloid Beta-Peptide (12-28) (human)CAS: 107015-83-8Purity: >95.00%
Amyloid Beta-Peptide (12-28) (human)은 아밀로이드 베타 단백질 (1-42) (Aβ (1-42))의 펩타이드 조각이다.
- GP10065Endomorphin-1CAS: 189388-22-5Purity: >98.00%
Endomorphin-1 is a highly selective μ-opioid receptor agonist (K i =1.11nM) with high affinity for kappa3 binding sites (K i =20-30nM).
- GP10075PKA inhibitor fragment (6-22) amideCAS: 121932-06-7Purity: >98.00%
A synthetic peptide inhibitor of PKA
- GP10077Angiotensin (1-7)CAS: 51833-78-4Purity: >98.00%
Angiotensin (1-7)은 심장과 신장에서 발견되는 헵타펩타이드로 혈장과 심방 조직에서 안지오텐신 전환효소(ACE)를 억제하고 각각의 IC50은 3.0과 4.0μM이다.
- GP10082Amyloid Beta-peptide (25-35) (human)CAS: 131602-53-4Purity: >98.50%
Amyloid Beta-peptide (25-35) (human)은 신경 독성 효과가 있는 알츠하이머 아밀로이드 베타 펩타이드의 일부이다.
| Catalog No. | Product Name | CAS No. | Purity | Structure |
|---|---|---|---|---|
| GC91864 | CXCL9 (74-103) (human) (trifluoroacetate salt) | - | >98.00% | |
Chemokine (C-X-C motif) ligand 9 (CXCL9) (74-103) is a C-terminal fragment of mature CXCL9. | ||||
| GC91865 | WaTx (36-68) (scorpion) (trifluoroacetate salt) | - | >95.00% | |
Wasabi receptor toxin (WaTx) (36-68) is a cell-penetrating peptide that corresponds to the mature toxin sequence and is an activator of transient receptor potential ankyrin 1 (TRPA1). | ||||
| GC91866 | Apelin-36 (trifluoroacetate salt) | - | >95.00% | |
The apelin gene encodes a preproprotein that is processed to generate a variety of bioactive peptides, including those having 36, 17, or 13 amino acids (apelin-36, apelin-17, and apelin-13, respectively). | ||||
| GC91867 | SNX-482 (ammonium salt) | - | >95.00% | |
SNX-482 is a peptide originally isolated from H. gigas venom that acts as a class E/R-type voltage-sensitive calcium channel blocker (IC50 = 30 nM in 192C cells expressing human class E channels). | ||||
| GC91868 | Glucose-dependent Insulinotropic Polypeptide (1-39) (porcine) (trifluoroacetate salt) | - | >98.00% | |
Glucose-dependent Insulinotropic Polypeptide (GIP) (1-39) is an endogenous 39-amino acid peptide hormone that induces insulin secretion. | ||||
| GC91869 | Retatrutide (sodium salt) | - | >98.00% | |
Retatrutide is a triple agonist of the glucagon receptor (GCGR), glucagon-like peptide 1 receptor (GLP-1R), and gastric inhibitory polypeptide receptor (GIP receptor), also known as the glucose-dependent insulinotropic polypeptide receptor. | ||||
| GC91870 | Glucose-dependent Insulinotropic Polypeptide (3-42) (human) (trifluoroacetate salt) | - | >90.00% | |
Gastric inhibitory peptide 1 (GIP-1) (3-42) is a peptide fragment of the incretin hormone GIP and a GIP receptor antagonist. | ||||
| GC92011 | Tetrapeptide-1 (acetate) | - | >98.00% | |
Tetrapeptide-1 (acetate)는 생물 활성 펩타이드의 일종이다. | ||||
| GC92124 | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt) | - | >95.00% | |
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt)은 내인성 인크레틴 호르몬 글루카곤 유사 펩타이드 1 (GLP-1)의 유도체이다. | ||||
| GC92126 | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt) | - | >95.00% | |
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt) 는 펩타이드의 일종이다. | ||||
| GP10006 | Myelin Basic Protein (68-82), guinea pig | 98474-59-0 | >98.00% | |
| GP10022 | Dynamin inhibitory peptide | 251634-21-6 | >98.00% | |
| GP10023 | Angiotensin II | 4474-91-3 | >99.50% | |
Angiotensin II는 레닌-안지오텐신 시스템 (RAS)의 주요 이펙터 펩타이드이다. | ||||
| GP10031 | Leptin (116-130) amide (mouse) | 258276-95-8 | >99.00% | |
| GP10049 | Amyloid Beta-Peptide (12-28) (human) | 107015-83-8 | >95.00% | |
Amyloid Beta-Peptide (12-28) (human)은 아밀로이드 베타 단백질 (1-42) (Aβ (1-42))의 펩타이드 조각이다. | ||||
| GP10057 | Amyloid β-Peptide (10-20) (human) | 152286-31-2 | >98.00% | |
| GP10065 | Endomorphin-1 | 189388-22-5 | >98.00% | |
Endomorphin-1 is a highly selective μ-opioid receptor agonist (K i =1.11nM) with high affinity for kappa3 binding sites (K i =20-30nM). | ||||
| GP10067 | Angiotensin 1/2 (1-6) | 47896-63-9 | >98.00% | |
| GP10074 | Angiotensin 1/2 (1-5) | 58442-64-1 | >98.00% | |
| GP10075 | PKA inhibitor fragment (6-22) amide | 121932-06-7 | >98.00% | |
A synthetic peptide inhibitor of PKA | ||||
| GP10077 | Angiotensin (1-7) | 51833-78-4 | >98.00% | |
Angiotensin (1-7)은 심장과 신장에서 발견되는 헵타펩타이드로 혈장과 심방 조직에서 안지오텐신 전환효소(ACE)를 억제하고 각각의 IC50은 3.0과 4.0μM이다. | ||||
| GP10082 | Amyloid Beta-peptide (25-35) (human) | 131602-53-4 | >98.50% | |
Amyloid Beta-peptide (25-35) (human)은 신경 독성 효과가 있는 알츠하이머 아밀로이드 베타 펩타이드의 일부이다. | ||||
| GP10083 | Beta-Amyloid (1-11) | 190436-05-6 | >98.00% | |
| GP10085 | Thrombin Receptor Activator for Peptide 5 (TRAP-5) | 141685-53-2 | >98.00% | |