GLPBio

Glucagon Receptor

Glucagon receptor is a member of the class B G-protein coupled family of receptors and is activated by glucagon, resulting in activation of adenylate cyclase and increased levels of intracellular cAMP.

Products Related to Glucagon Receptor(54)

  • GC31363 structure
    GC31363GLP-1 receptor agonist 1
    CAS: 2212020-52-3
    Purity: >99.00%

    GLP-1 receptor agonist 1 (GLP-1 receptor agonist 1) is a GLP-1 receptor agonist extracted from patent WO2018056453A1, Compound 67.

  • GC31379 structure
    GC31379GRA Ex-25
    CAS: 307983-31-9
    Purity: >98.00%

    GRA Ex-25 is a potent glucagon receptor inhibitor with IC 50 of 56nm and 55nM for rat and human glucagon receptors, respectively.

  • GC31404 structure
    GC31404Semaglutide
    CAS: 910463-68-2
    Purity: >98.00%

    Semaglutide is a long-acting analogue of human glucagon-like peptide-1 and an agonist for the human glucagon-like peptide-1 (GLP-1) receptor.

  • GC31416 structure
    GC31416HAEGTFTSDVS
    CAS: 864915-61-7
    Purity: >98.00%

    HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide.

  • GC31436 structure
    GC31436HAEGTFTSD
    CAS: 926018-45-3
    Purity: >98.00%

    HAEGTFTSD is a 9-residue peptide of human GLP-1 peptide or GLP-1(7-36), amide.

  • GC33759 structure
    GC33759GLP-1(7-36) Acetate (Human GLP-1-(7-36)-amide Acetate)
    CAS: 1119517-19-9
    Purity: >98.00%

    GLP-1(7-36) Acetate (Human GLP-1-(7-36)-amide Acetate) is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.

  • GC34244 structure
    GC34244GLP-1 moiety from Dulaglutide
    CAS: 1197810-60-8
    Purity: >98%

    GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist, extracted from patent US 20160369010 A1.

  • GC34245 structure
    GC34245GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
    Purity: >99.00%

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • GC34246 structure
    GC34246FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
    Purity: >98.00%

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • GC34249 structure
    GC34249KQMEEEAVRLFIEWLKNGGPSSGAPPPS
    Purity: >98%
  • GC34328 structure
    GC34328Semaglutide TFA
    Purity: >98.00%

    Semaglutide TFA, a long-acting GLP-1 analogue, is a glucagon-like peptide-1 (GLP-1) receptor agonist.

  • GC34904 structure
    GC34904GLP-1(7-37) acetate
    CAS: 1450806-98-0
    Purity: >98.50%

    GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.

  • GC36147 structure
    GC36147GLP-1 receptor agonist 2
    CAS: 2230197-64-3
    Purity: >99.00%

    GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist.

  • GC36148 structure
    GC36148GLP-1R Antagonist 1
    CAS: 488097-06-9
    Purity: >99.50%

    GLP-1R Antagonist 1 (compound 5d) is an orally active, CNS penetrant and non-competitive antagonist of glucagon-like peptide 1 receptor (GLP-1R), with an IC50 of 650 nM.

  • GC36150 structure
    GC36150Glucagon-Like Peptide (GLP) I (7-36), amide, human
    CAS: 107444-51-9
    Purity: >98%

    Glucagon-Like Peptide (GLP) I (7-36), amide, human is a physiological incretin hormone that stimulates insulin secretion.

  • GC36152 structure
    GC36152Glucagon-like peptide 1 (1-37), human (TFA)
    Purity: >98%
  • GC36753 structure
    GC36753NNC-0640
    CAS: 307986-98-7
    Purity: >98.00%

    NNC-0640 is a potent human G-protein-coupled glucagon receptor (GCGR) negative allosteric modulator (NAM) with an IC50 of 69.2 nM.

  • GC37929 structure
    GC37929VU0453379
    CAS: 1638646-27-1
    Purity: >98%

    VU0453379 is a highly selective and central nervous system (CNS) penetrant positive allosteric modulator (PAM) of glucagon-like peptide-1R (GLP-1R) with an EC50 of 1.3 μM.

  • GC38495 structure
    GC38495Secretin (33-59), rat TFA
    Purity: >98%

    Secretin (33-59), rat (TFA) is a 27-aa peptide, which acts on secretin receptor, and enhances the secretion of bicarbonate, enzymes, and K+ from the pancreas.

  • GC38832 structure
    GC38832PF-06882961
    CAS: 2230198-02-2
    Purity: >97.00%

    PF-06882961 is a potent, orally active glucagon-like peptide-1 receptor (GLP-1R) agonist.

  • GC39323 structure
    GC39323{Val1}-Exendin-3/4
    Purity: >99.00%

    {Val1}-Exendin-3/4 is the first N-terminal 1-28 residues of Exendin-4 peptide.

  • GC39364 structure
    GC39364Cotadutide acetate
    Purity: >98.00%

    Cotadutide (MEDI0382) acetate is a potent dual agonist of glucagon-like peptide-1 (GLP-1) and GCGR with EC50 values of 6.9 pM and 10.2 pM, respectively.

  • GC43644 structure
    GC43644Exendin-4 (acetate)
    CAS: 914454-01-6
    Purity: >99.00%

    Exendin-4 is a potent peptide agonist of the glucagon-like peptide 1 (GLP-1) receptor (Ki = 136 pM).

  • GC43761 structure
    GC43761GLP-1 (1-37) (human, rat, mouse, bovine) (trifluoroacetate salt)
    CAS: 87805-34-3
    Purity: >98.00%

    GLP-1 (1-37) (human, rat, mouse, bovine) (trifluoroacetate salt) is a full-length precursor form of glucagon-like peptide-1 secreted by the intestine.