Peptides
Research Areas
Products Related to Peptides(2426)
- GC91859LL-37 (13-37) (human) (trifluoroacetate salt)Purity: >95.00%
LL-37 (13-37) is an anticancer peptide fragment of LL-37 .
- GC91860Glucose-dependent Insulinotropic Peptide (22-51) (human) (trifluoroacetate salt)Purity: >98.00%
Glucose-dependent insulinotropic peptide (GIP) (22-51) is a pro-atherogenic 30-amino acid peptide corresponding to residues 22-51 of the GIP precursor protein proGIP that has been found in human plasma.
- GC91861[Gly8,36,Glu22]-GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) (acetate)Purity: >98.00%
[Gly8,36,Glu22]-Glucagon-like peptide 1 ([Gly8,36,Glu22]-GLP-1) (7-37) is a derivative of GLP-1 containing alanine-to-glycine, glycine-to-glutamate, and arginine-to-glycine substitutions at positions 8, 22, and 36, respectively, and a peptide fragment of the GLP-1 receptor (GLP-1R) agonist dulaglutide.
- GC91862Exendin-3 (9-39) amide (trifluoroacetate salt)Purity: >95.00%
Exendin-3 (9-39) amide is a truncated form of the exendin-4 (48-86) amide peptide that acts as a potent competitive antagonist for the glucagon-like peptide 1 receptor (GLP-1R; Kd = 1.7 nM in CHL cells transfected with cloned human GLP-1).
- GC91863GLP-1 (1-32) (bullfrog) (trifluoroacetate salt)Purity: >98.00%
Glucagon-like peptide 1 (GLP-1) (1-32) is an endogenous incretin hormone.
- GC91864CXCL9 (74-103) (human) (trifluoroacetate salt)Purity: >98.00%
Chemokine (C-X-C motif) ligand 9 (CXCL9) (74-103) is a C-terminal fragment of mature CXCL9.
- GC91865WaTx (36-68) (scorpion) (trifluoroacetate salt)Purity: >95.00%
Wasabi receptor toxin (WaTx) (36-68) is a cell-penetrating peptide that corresponds to the mature toxin sequence and is an activator of transient receptor potential ankyrin 1 (TRPA1).
- GC91866Apelin-36 (trifluoroacetate salt)Purity: >95.00%
The apelin gene encodes a preproprotein that is processed to generate a variety of bioactive peptides, including those having 36, 17, or 13 amino acids (apelin-36, apelin-17, and apelin-13, respectively).
- GC91867SNX-482 (ammonium salt)Purity: >95.00%
SNX-482 is a peptide originally isolated from H. gigas venom that acts as a class E/R-type voltage-sensitive calcium channel blocker (IC50 = 30 nM in 192C cells expressing human class E channels).
- GC91868Glucose-dependent Insulinotropic Polypeptide (1-39) (porcine) (trifluoroacetate salt)Purity: >98.00%
Glucose-dependent Insulinotropic Polypeptide (GIP) (1-39) is an endogenous 39-amino acid peptide hormone that induces insulin secretion.
- GC91869Retatrutide (sodium salt)Purity: >98.00%
Retatrutide is a triple agonist of the glucagon receptor (GCGR), glucagon-like peptide 1 receptor (GLP-1R), and gastric inhibitory polypeptide receptor (GIP receptor), also known as the glucose-dependent insulinotropic polypeptide receptor.
- GC91870Glucose-dependent Insulinotropic Polypeptide (3-42) (human) (trifluoroacetate salt)Purity: >90.00%
Gastric inhibitory peptide 1 (GIP-1) (3-42) is a peptide fragment of the incretin hormone GIP and a GIP receptor antagonist.
- GC92124FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt)Purity: >95.00%
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a derivative of the endogenous incretin hormone glucagon-like peptide 1 (GLP-1).
- GC92126GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt)Purity: >95.00%
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a peptide.
- GP10023Angiotensin IICAS: 4474-91-3Purity: >99.50%
Angiotensin II is a major effector peptide of the renin-angiotensin system (RAS).
- GP10049Amyloid Beta-Peptide (12-28) (human)CAS: 107015-83-8Purity: >95.00%
Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)).
| Catalog No. | Product Name | CAS No. | Purity | Structure |
|---|---|---|---|---|
| GC91859 | LL-37 (13-37) (human) (trifluoroacetate salt) | - | >95.00% | |
LL-37 (13-37) is an anticancer peptide fragment of LL-37 . | ||||
| GC91860 | Glucose-dependent Insulinotropic Peptide (22-51) (human) (trifluoroacetate salt) | - | >98.00% | |
Glucose-dependent insulinotropic peptide (GIP) (22-51) is a pro-atherogenic 30-amino acid peptide corresponding to residues 22-51 of the GIP precursor protein proGIP that has been found in human plasma. | ||||
| GC91861 | [Gly8,36,Glu22]-GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) (acetate) | - | >98.00% | |
[Gly8,36,Glu22]-Glucagon-like peptide 1 ([Gly8,36,Glu22]-GLP-1) (7-37) is a derivative of GLP-1 containing alanine-to-glycine, glycine-to-glutamate, and arginine-to-glycine substitutions at positions 8, 22, and 36, respectively, and a peptide fragment of the GLP-1 receptor (GLP-1R) agonist dulaglutide. | ||||
| GC91862 | Exendin-3 (9-39) amide (trifluoroacetate salt) | - | >95.00% | |
Exendin-3 (9-39) amide is a truncated form of the exendin-4 (48-86) amide peptide that acts as a potent competitive antagonist for the glucagon-like peptide 1 receptor (GLP-1R; Kd = 1.7 nM in CHL cells transfected with cloned human GLP-1). | ||||
| GC91863 | GLP-1 (1-32) (bullfrog) (trifluoroacetate salt) | - | >98.00% | |
Glucagon-like peptide 1 (GLP-1) (1-32) is an endogenous incretin hormone. | ||||
| GC91864 | CXCL9 (74-103) (human) (trifluoroacetate salt) | - | >98.00% | |
Chemokine (C-X-C motif) ligand 9 (CXCL9) (74-103) is a C-terminal fragment of mature CXCL9. | ||||
| GC91865 | WaTx (36-68) (scorpion) (trifluoroacetate salt) | - | >95.00% | |
Wasabi receptor toxin (WaTx) (36-68) is a cell-penetrating peptide that corresponds to the mature toxin sequence and is an activator of transient receptor potential ankyrin 1 (TRPA1). | ||||
| GC91866 | Apelin-36 (trifluoroacetate salt) | - | >95.00% | |
The apelin gene encodes a preproprotein that is processed to generate a variety of bioactive peptides, including those having 36, 17, or 13 amino acids (apelin-36, apelin-17, and apelin-13, respectively). | ||||
| GC91867 | SNX-482 (ammonium salt) | - | >95.00% | |
SNX-482 is a peptide originally isolated from H. gigas venom that acts as a class E/R-type voltage-sensitive calcium channel blocker (IC50 = 30 nM in 192C cells expressing human class E channels). | ||||
| GC91868 | Glucose-dependent Insulinotropic Polypeptide (1-39) (porcine) (trifluoroacetate salt) | - | >98.00% | |
Glucose-dependent Insulinotropic Polypeptide (GIP) (1-39) is an endogenous 39-amino acid peptide hormone that induces insulin secretion. | ||||
| GC91869 | Retatrutide (sodium salt) | - | >98.00% | |
Retatrutide is a triple agonist of the glucagon receptor (GCGR), glucagon-like peptide 1 receptor (GLP-1R), and gastric inhibitory polypeptide receptor (GIP receptor), also known as the glucose-dependent insulinotropic polypeptide receptor. | ||||
| GC91870 | Glucose-dependent Insulinotropic Polypeptide (3-42) (human) (trifluoroacetate salt) | - | >90.00% | |
Gastric inhibitory peptide 1 (GIP-1) (3-42) is a peptide fragment of the incretin hormone GIP and a GIP receptor antagonist. | ||||
| GC92011 | Tetrapeptide-1 (acetate) | - | >98.00% | |
Tetrapeptide-1 is a bioactive peptide. | ||||
| GC92124 | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt) | - | >95.00% | |
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a derivative of the endogenous incretin hormone glucagon-like peptide 1 (GLP-1). | ||||
| GC92126 | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt) | - | >95.00% | |
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a peptide. | ||||
| GP10006 | Myelin Basic Protein (68-82), guinea pig | 98474-59-0 | >98% | |
| GP10022 | Dynamin inhibitory peptide | 251634-21-6 | >98% | |
| GP10023 | Angiotensin II | 4474-91-3 | >99.50% | |
Angiotensin II is a major effector peptide of the renin-angiotensin system (RAS). | ||||
| GP10031 | Leptin (116-130) amide (mouse) | 258276-95-8 | >99.00% | |
| GP10049 | Amyloid Beta-Peptide (12-28) (human) | 107015-83-8 | >95.00% | |
Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)). | ||||
| GP10057 | Amyloid β-Peptide (10-20) (human) | 152286-31-2 | >98% | |
| GP10065 | Endomorphin-1 | 189388-22-5 | >98% | |
| GP10067 | Angiotensin 1/2 (1-6) | 47896-63-9 | >98% | |
| GP10074 | Angiotensin 1/2 (1-5) | 58442-64-1 | >98% | |