Search Site
  • 0
    سلة التسوق

    انقر هنا لمعرفة عدد العناصر التي أضفتها:)

    image loader

    إضافة عنصر (عناصر) إلى سلة التسوق ......

الصفحة الرئيسية >> Peptides

Peptides

منتجات لـ نبسب؛ Peptides

  1. القط. رقم اسم المنتج بيانات
  2. GC33788 Adrenocorticotropic Hormone (ACTH) (18-39), human (CLIP (human)) الهرمون الموجه لقشر الكظر (ACTH) (18-39) ، الإنسان (CLIP (الإنسان)) هو ببتيد الفص المتوسط القشري ، والذي ينتج في الميلانوتروف للفص المتوسط من الغدة النخامية. Adrenocorticotropic Hormone (ACTH) (18-39), human (CLIP (human)) Chemical Structure
  3. GC65059 Adrenocorticotropic Hormone (ACTH) (18-39), human TFA هرمون قشر الكظر (ACTH) (18-39) ، TFA البشري هو الببتيد الفصوص القشري المتوسط ==، والذي يتم إنتاجه في الميلانوتروف للفص المتوسط ==من الغدة النخامية Adrenocorticotropic Hormone (ACTH) (18-39), human TFA Chemical Structure
  4. GC33790 Adrenocorticotropic Hormone (ACTH) (4-10), human هرمون قشر الكظر (ACTH) (4-10) ، الإنسان هو ناهض مستقبلات الميلانوكورتين 4 (MC4R) Adrenocorticotropic Hormone (ACTH) (4-10), human Chemical Structure
  5. GC42737 Adrenomedullin (1-12) (human) (trifluoroacetate salt) Adrenomedullin (1-12) is an N-terminal fragment of adrenomedullin (1-52). Adrenomedullin (1-12) (human) (trifluoroacetate salt) Chemical Structure
  6. GC34230 Adrenomedullin (1-50), rat Adrenomedullin (1-50) ، فأر هو عبارة عن 50 ببتيد من الأحماض الأمينية ، مما يؤدي إلى توسع الأوعية الشرياني الانتقائي عن طريق تنشيط مستقبل CGRP1 Adrenomedullin (1-50), rat Chemical Structure
  7. GC35256 Adrenomedullin (11-50), rat Adrenomedullin (11-50) ، فأر هو جزء C- طرفي (11-50) من أدرينوميدولين الجرذ Adrenomedullin (11-50), rat Chemical Structure
  8. GC42738 Adrenomedullin (13-52) (human) (trifluoroacetate salt) Adrenomedullin (13-52) is a truncated form of adrenomedullin (1-52). Adrenomedullin (13-52) (human) (trifluoroacetate salt) Chemical Structure
  9. GC35257 Adrenomedullin (16-31), human Adrenomedullin (16-31) ، الإنسان هو بقايا الأحماض الأمينية 16-31 جزء من الأدرينوميدولين البشري (hADM) Adrenomedullin (16-31), human Chemical Structure
  10. GC42741 Adrenomedullin (22-52) (human) (trifluoroacetate salt) Adrenomedullin (22-52) is a C-terminal fragment of adrenomedullin (1-52). Adrenomedullin (22-52) (human) (trifluoroacetate salt) Chemical Structure
  11. GC33955 Adrenomedullin (AM) (1-52), human Adrenomedullin (AM) (1-52) ، الإنسان عبارة عن ببتيد مكون من 52 حمض أميني ، والذي يؤثر على تكاثر الخلايا وتكوين الأوعية في السرطان. Adrenomedullin (AM) (1-52), human Chemical Structure
  12. GC32622 Adrenomedullin (AM) (13-52), human Adrenomedullin (AM) (13-52) ، الإنسان عبارة عن 40 ببتيد من الأحماض الأمينية ، يعمل كعامل موسع للأوعية يعتمد على البطانة Adrenomedullin (AM) (13-52), human Chemical Structure
  13. GC32615 Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin (human)) Adrenomedullin (AM) (22-52) ، بشري (22-52-Adrenomedullin (بشري)) ، نظير أدرينوميدولين مبتور طرفي NH2 ، هو مضاد لمستقبلات الأدرينوميدولين ، كما أنه يعادي مستقبل الببتيد الناتج عن الكالسيتونين (CGRP) في الأوعية الدموية الخلفية سرير القط. Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin (human)) Chemical Structure
  14. GC11039 AF 12198 AF 12198 هو مضاد ببتيد قوي وانتقائي ومحدد للمستقبلات البشرية من النوع الأول إنترلوكين -1 (IL1-R1) (IC50 \u003d 8 نانومتر) ولكن ليس مستقبل النوع البشري الثاني (IC50 \u003d 6.7 ميكرومتر) أو مستقبل النوع الأول من الفئران ( IC50\u003e 200 ميكرومتر). AF 12198 Chemical Structure
  15. GC35264 AGA-(C8R) HNG17, Humanin derivative AGA- (C8R) HNG17 ، مشتق Humanin هو مشتق قوي من البشر (HN) AGA-(C8R) HNG17, Humanin derivative Chemical Structure
  16. GC61526 AGA-(C8R) HNG17, humanin derivative TFA AGA- (C8R) HNG17 ، مشتق TFA البشري هو مشتق قوي من البشر (HN) AGA-(C8R) HNG17, humanin derivative TFA Chemical Structure
  17. GC14867 Agitoxin 2 Agitoxin 2 هو مثبط قناة K+ ، بقيم IC50 تبلغ 201 pM و 144 pM لـ mKV1.3 و mKV1.1 ، على التوالي). Agitoxin 2 Chemical Structure
  18. GC15822 Akt/SKG Substrate Peptide Akt / SKG Substrate Peptide عبارة عن ببتيد اصطناعي مناسب كركيزة لـ Akt / PKB ، والتي لا يتم فسفرتها بواسطة p70S6K أوMAPK1 Akt/SKG Substrate Peptide Chemical Structure
  19. GC35282 Alexamorelin Met 1 Alexamorelin Met 1 Chemical Structure
  20. GC19584 Alkaline Phosphatase الفوسفاتيز القلوي هو بروتين سكري مرتبط بالغشاء يحفز التحلل المائي لأحادي الاسترات الفوسفات عند قيم الأس الهيدروجيني الأساسية Alkaline Phosphatase Chemical Structure
  21. GC35291 Allatostatin II ألاتوستاتين الثاني هو ديكاببتيد Allatostatin II Chemical Structure
  22. GC35292 Allatostatin IV ألاتوستاتين الرابع هو ثماني الببتيد Allatostatin IV Chemical Structure
  23. GC30940 Allergen Gal d 4 (46-61), chicken (Lysozyme C (46-61) (chicken)) Allergen Gal d 4 (46-61) ، دجاج (ليسوزيم C (46-61) (دجاج)) عبارة عن ببتيد ليزوزيم بياض دجاجة. Allergen Gal d 4 (46-61), chicken (Lysozyme C (46-61) (chicken)) Chemical Structure
  24. GC35304 Alpha 1(I) Collagen (614-639), human ألفا 1 (1) كولاجين (614-639) ، الإنسان عبارة عن جزء من الببتيد من الكولاجين ألفا 1 من النوع الأول Alpha 1(I) Collagen (614-639), human Chemical Structure
  25. GC32208 ALX 40-4C ALX 40-4C هو مثبط ببتيد صغير للمستقبل الكيميائي CXCR4 ، ويمنع SDF-1 من ربط CXCR4 بـ Ki 1 ميكرومتر ، ويمنع تكرار سلالات X4 من HIV-1 ؛ ALX 40-4C Trifluoroacetate يعمل أيضًا كمضاد لمستقبل APJ ، مع IC50 من 2.9 ميكرومتر ALX 40-4C Chemical Structure
  26. GC34386 ALX 40-4C Trifluoroacetate ALX 40-4C Trifluoroacetate عبارة عن مثبط ببتيد صغير لمستقبلات chemokine CXCR4 ، ويمنع SDF-1 من ربط CXCR4 بـ Ki من 1 ميكرومتر ، ويمنع تكرار سلالات X4 من HIV-1 ؛ ALX 40-4C Trifluoroacetate يعمل أيضًا كمضاد لمستقبل APJ ، مع IC50 من 2.9 ميكرومتر ALX 40-4C Trifluoroacetate Chemical Structure
  27. GC49262 Alytesin (trifluoroacetate salt) A neuropeptide with diverse biological activities Alytesin (trifluoroacetate salt) Chemical Structure
  28. GC30514 AMARA peptide AMARA الببتيد هو ركيزة لـ SIK و AMPK AMARA peptide Chemical Structure
  29. GC34224 AMARA peptide TFA AMARA peptide (TFA) عبارة عن ركيزة للكيناز المحفز بالملح (SIK) والبروتين المنشط أحادي الفوسفات (AMPK) AMARA peptide TFA Chemical Structure
  30. GC35324 Amlodipine aspartic acid impurity شوائب حمض الأسبارتيك أملوديبين هي شوائب حمض الأسبارتيك أملوديبين Amlodipine aspartic acid impurity Chemical Structure
  31. GC16513 Amylin الأميلين ، عديد ببتيد حمض أميني 37 ، هو هرمون البنكرياس المفرز مع الأنسولين الذي يمارس أدوارًا فريدة في عملية التمثيل الغذائي واستتباب الجلوكوز. Amylin Chemical Structure
  32. GA20710 Amylin (8-37) (human) Human IAPP (8-37), ATQRLANFLVHSSNNFGAILSSTNVGSNTY-amide, readily forms fibrils in vitro. Amylin (8-37) (human) Chemical Structure
  33. GC35331 Amylin (8-37), rat الأميلين (8-37) ، الجرذ هو نظير مبتور للأميلين الأصلي الذي يمنع بشكل انتقائي امتصاص الجلوكوز المرتبط بالأنسولين وترسب الجليكوجين في أنسجة العضلات Amylin (8-37), rat Chemical Structure
  34. GA24066 Amylin (free acid) (human) Amylin (free acid) (human) Chemical Structure
  35. GC42796 Amylin (human) (trifluoroacetate salt) Amylin is a 37-residue peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety. Amylin (human) (trifluoroacetate salt) Chemical Structure
  36. GC35332 Amylin (IAPP), feline Amylin (IAPP) ، القطط عبارة عن بولي ببتيد 37 حمض أميني من القطط Amylin (IAPP), feline Chemical Structure
  37. GC60581 Amylin (IAPP), feline TFA Amylin (IAPP) ، القطط TFA عبارة عن بولي ببتيد 37 حمض أميني من القطط Amylin (IAPP), feline TFA Chemical Structure
  38. GC35333 Amylin, amide, rat الأميلين ، الأميد ، الجرذ عبارة عن يجند قوي وعالي التقارب لمستقبلات Amylin AMY1 و AMY3 ومتغير من مستقبلات AMY2 ؛ تستخدم دراسات الربط بشكل عام للمستقبل الأخير Amylin, amide, rat Chemical Structure
  39. GC35334 Amyloid β Peptide (42-1)(human) أميلويد β ؛ الببتيد (42-1) (الإنسان) هو الشكل غير النشط لأميلويد β ؛ الببتيد (1-42). Amyloid β Peptide (42-1)(human) Chemical Structure
  40. GC35335 Amyloid β-peptide (1-40) rat أميلويد β ؛ - الببتيد (1-40) فأر هو شكل جرذ من الأميلويد β ؛ - الببتيد ، الذي يتراكم على شكل رواسب خارج الخلية غير قابلة للذوبان حول الخلايا العصبية ، مما يؤدي إلى ظهور لويحات الشيخوخة المرتبطة بالزهايمر ' ؛ مرض (AD). Amyloid β-peptide (1-40) rat Chemical Structure
  41. GA20721 Amyloid β-Protein (1-12) Amyloid β-Protein (1-12) Chemical Structure
  42. GA20722 Amyloid β-Protein (1-14) The N-terminal Aβ fragments Aβ1-14, Aβ1-15 (H-6368), and Aβ1-16 (H-2958) are elevated in cell media and in CSF in response to γ-secretase inhibitor treatment. The presence of these small peptides is consistent with a catabolic amyloid precursor protein cleavage pathway by β- followed by α-secretase. It has been shown that Aβ1-14, Aβ1-15, and Aβ1-16 increase dose-dependently in response to γ-secretase inhibitor treatment while Aβ1-42 levels are unchanged. Amyloid β-Protein (1-14) Chemical Structure
  43. GA20724 Amyloid β-Protein (1-24) Amyloid β-Protein (1-24) Chemical Structure
  44. GA20725 Amyloid β-Protein (1-37) أميلويد β ؛ - يرتبط البروتين (1-37) بشكل معتدل بدرجات اختبار الحالة العقلية المصغرة (MMSE) في مرض الزهايمر. Amyloid β-Protein (1-37) Chemical Structure
  45. GA20726 Amyloid β-Protein (1-38) Like Aβ (25-35) (H-1192), the Aβ fragment (1-38) destabilizes calcium homeostasis and renders human cortical neurones vulnerable to environmental insults. Amyloid β-Protein (1-38) Chemical Structure
  46. GA20727 Amyloid β-Protein (1-39) Small quantities of Aβ37, 38 and 39 can be detected in CSF together with Aβ40, the most abundant Aβ homolog, Aβ42, and N-terminally truncated amyloid peptides. The relative amounts depend on the variant of Alzheimer's disease. The C-terminally truncated amyloid peptides are also found in amyloid plaques. Amyloid β-Protein (1-39) Chemical Structure
  47. GA20728 Amyloid β-Protein (1-40) (scrambled) Amyloid β-Protein (1-40) (scrambled) Chemical Structure
  48. GA20729 Amyloid β-Protein (1-40) amide Amyloid β-Protein (1-40) amide Chemical Structure
  49. GA24067 Amyloid β-Protein (1-40)-Lys(biotinyl) amide For immobilization of Aβ40. Amyloid β-Protein (1-40)-Lys(biotinyl) amide Chemical Structure
  50. GA20733 Amyloid β-Protein (1-42)

    Compared to the inner salt, the HCl salt of Aβ42 aggregates more readily at pH 7.4.

     Amyloid β-Protein (1-42) Chemical Structure
  51. GA20730 Amyloid β-Protein (1-42) (HFIP-treated) H-7442 was obtained by dissolving Amyloid β-Protein (1-42) (H-1368) in HFIP, aliquoting, and removing the solvent as described in the literature. Amyloid β-Protein (1-42) (HFIP-treated) Chemical Structure
  52. GA20731 Amyloid β-Protein (1-42) (scrambled) Amyloid β-Protein (1-42) (scrambled) Chemical Structure
  53. GA24068 Amyloid β-Protein (1-42)-Lys(biotinyl) amide For immobilization of Aβ42. Amyloid β-Protein (1-42)-Lys(biotinyl) amide Chemical Structure
  54. GA20736 Amyloid β-Protein (1-43) أميلويد β ؛ -البروتين (1-43) أكثر عرضة للتجمع وله خصائص سامة أعلى من Aβ المعروف منذ فترة طويلة ؛ 1-42. Amyloid β-Protein (1-43) Chemical Structure
  55. GA20737 Amyloid β-Protein (1-46) Precursor of the secreted amyloid β-protein (1-40) and (1-42). The identification of amyloid-β-protein (1-46) led to the identification of a zeta-cleavage site between the known γ- and ε-cleavage sites within the transmembrane domain of amyloid-β precursor protein (APP). Amyloid β-Protein (1-46) Chemical Structure
  56. GA20738 Amyloid β-Protein (1-6) Experiments using sub-peptides of Aβ42 revealed that the epitope identified by the antibody A8, as described by Ying and coworkers, lies within the 1-6 region of Aβ. The antibody displays high affinity for soluble Aβ42 oligomers in the molecular weight range of 16.5-25 kDa, and detected target antigen in brain sections from senescence-accelerated SAMP 8 mice. Amyloid β-Protein (1-6) Chemical Structure
  57. GA20739 Amyloid β-Protein (1-6) amide Experiments using sub-peptides of Aβ42 revealed that the epitope identified by the antibody A8, as described by Ying and coworkers, lies within the 1-6 region of Aβ. The antibody displays high affinity for soluble Aβ42 oligomers in the molecular weight range of 16.5-25 kDa, and detected target antigen in brain sections from senescence-accelerated SAMP 8 mice. Amidated or acetylated and amidated forms of the sequence were used for example for quantitative structure retention relationships (QSRR) experiments. The latter could allow prediction of reversed-phase high-performance liquid chromatography (HPLC) retention of peptides, as reported by Kaliszan and coworkers. Amyloid β-Protein (1-6) amide Chemical Structure
  58. GA20720 Amyloid β-Protein (10-35) Amyloid β-protein (10-35), YEVHHQKLVFFAEDVGSNKGAIIGLM, was used as a truncated peptide model for the full-length amyloid β-proteins (1-40) and (1-42) in high-resolution structural studies. In contrast to the full-length amyloid β-proteins, amyloid β-protein (10-35) allowed the controlled and reproducible formation of homogeneous fibrils from aqueous solutions of defined pH, ionic strength and soluble peptide concentration necessary for high-resolution structural studies. Amyloid β-Protein (10-35) Chemical Structure
  59. GA20723 Amyloid β-Protein (11-42) Amyloid β-Protein (11-42) Chemical Structure
  60. GA20740 Amyloid β-Protein (16-20) KLVFF corresponds to the minimum sequence binding the full-length amyloid β protein. The pentapeptide acts as a β-sheet breaker. Amyloid β-Protein (16-20) Chemical Structure
  61. GA20741 Amyloid β-Protein (16-22) Self-assembling Aβ sequence. Amyloid β-Protein (16-22) Chemical Structure
  62. GA20742 Amyloid β-Protein (17-40) Cleavage of APP by alpha- and gamma-secretase (i.e. the non-amyloidogenic pathway) yields p3 peptide, a mix of Aβ 17-40 and Aβ 17-42. p3 is a major constituent of diffuse plaques observed in AD brains and pre-amyloid plaques in people affected by Down syndrome. Amyloid β-Protein (17-40) Chemical Structure
  63. GA24069 Amyloid β-Protein (17-42) Cleavage of APP by alpha- and gamma secretase (i. Amyloid β-Protein (17-42) Chemical Structure
  64. GA20744 Amyloid β-Protein (2-42) Aβ 2-42 could be a biomarker for differentiating AD from other degenerative dementias, such as frontotemporal dementias (FTD). The peptide promotes phagocytosis by macrophages. Amyloid β-Protein (2-42) Chemical Structure
  65. GA20743 Amyloid β-Protein (20-29) FAEDVGSNKG. Amyloid β-Protein (20-29) Chemical Structure
  66. GA20745 Amyloid β-Protein (25-35) amide The amidation of amyloid β-protein (25-35) leads to a product in which the amyloidogenic capacity of amyloid β-protein (25-35) has been strongly reduced, while the neurotoxic activity was found to be independent of the aggregated state of the peptide. Amyloid β-Protein (25-35) amide Chemical Structure
  67. GA20747 Amyloid β-Protein (3-40) Amyloid β-Protein (3-40) Chemical Structure
  68. GA20748 Amyloid β-Protein (3-42) The N-terminally truncated Aβ42 may be formed in increased amounts as AD progresses. Aβ 3-42 is the precursor of the Pyr-peptide. (Pyr³)-Aβ 3-42 positive plaques are resistant to age-dependent degradation likely due to their high stability and propensity to aggregate. Amyloid β-Protein (3-42) Chemical Structure
  69. GA20746 Amyloid β-Protein (33-42) GLMVGGVVIA, a partial sequence of β-amyloid protein which is used for raising antibodies against Aβ 1-42. Li et al. studied the aggregation behavior of this and other Aβ 1-42 C-terminal fragments. Amyloid β-Protein (33-42) Chemical Structure
  70. GA20749 Amyloid β-Protein (35-25) Reverse sequence of Aβ 25-35, inactive control. Amyloid β-Protein (35-25) Chemical Structure
  71. GA20750 Amyloid β-Protein (36-38) Amyloid β-Protein (36-38) Chemical Structure
  72. GA20751 Amyloid β-Protein (37-39) Amyloid β-Protein (37-39) Chemical Structure
  73. GA20754 Amyloid β-Protein (4-42) Aβ 4-42 could be one of the earliest and most prominent Aβ species deposited in AD brain. Sequencing of amyloid plaque cores showed that 64% of the isolated Aβ had a phenylalanine at its N-terminus, and indeed, IP/MS experiments identified Aβ 4-42 as a major Aβ species in AD patients. Additionally, Aβ 4-42 was found to be a component of cotton wool plaques in familial AD patients with the V261I PS1 mutation. Aβ 4-42 was discovered as well in amyloid deposits from vascular dementia and familial Danish dementia patients. These observations indicate that Aβ 4-42 may contribute to the development of multiple CNS diseases. Amyloid β-Protein (4-42) Chemical Structure
  74. GA20753 Amyloid β-Protein (40-1) Inactive control Amyloid β-Protein (40-1) Chemical Structure
  75. GA20752 Amyloid β-Protein (40-1) Reverse sequence of Aβ 1-40. Amyloid β-Protein (40-1) Chemical Structure
  76. GA20755 Amyloid β-Protein (5-42) Abeta 5-42 is produced from amyloid precursor protein by action of caspases. It is deposited in Alzheimer's disease brain as well, but less prone to aggregation. Amyloid β-Protein (5-42) Chemical Structure
  77. GA20756 Amyloid β-Protein (6-20) Amyloid β-Protein (6-20) Chemical Structure
  78. GA20718 Amyloid β/A4 Protein Precursor₇₇₀ (667-676) The peptide substrate APP (667-676), SEVKMDAEFR, corresponds to the wild-type amyloid precursor protein (APP) β-secretase cleavage site. SEVKMDAEFR has been used for assaying β-secretase activity. Amyloid β/A4 Protein Precursor₇₇₀ (667-676) Chemical Structure
  79. GA20719 Amyloid β/A4 Protein Precursor₇₇₀ (740-770) Amyloid β/A4 Protein Precursor??? (740-770) corresponds to a C-terminal amyloid precursor protein (APP) fragment known as C31. This fragment is intracellularly generated by proteolytic cleavage of APP by caspases-8 and -9. C31 had a proapoptotic and a cytotoxic effect on neuronal cells and was shown to be present in brains of Alzheimer's disease (AD) patients. In cultured cells caspase cleavage of APP was induced by amyloid β-protein and the subsequent generation of C31 contributed to the apoptotic cell death associated with amyloid β-protein. Amyloid precursor binding protein BP1 (APP-BP1) a cell cycle protein which is increased in AD brain was demonstrated to bind to the C31 region of APP and to mediate APP-induced apoptosis. Amyloid β/A4 Protein Precursor₇₇₀ (740-770) Chemical Structure
  80. GP10118 Amyloid Beta-Peptide (1-40) (human)

    ببتيد أميلويد بيتا (1-40) (الإنسان)، (C194H295N53O58S1)، وهو ببتيد يحتوي على التسلسل H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH، الكتلة الجزيئية = 4329.8. يعد أميلويد بيتا (Aβ أو Abeta) من الببتيدات المكونة لـ 36-43 حمضًا أمينية والذي يُصَنَّع من بروتين مُستَخِرِج الأميلود.

     Amyloid Beta-Peptide (1-40) (human) Chemical Structure
  81. GP10049 Amyloid Beta-Peptide (12-28) (human)

    Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)).

     Amyloid Beta-Peptide (12-28) (human) Chemical Structure
  82. GP10082 Amyloid Beta-peptide (25-35) (human)

    الببتيد بيتا الأميلويد (25-35) (الإنسان) هو جزء من ببتيد أميلويد بيتا في مرض الزهايمر وله تأثيرات عصبية سامة.

     Amyloid Beta-peptide (25-35) (human) Chemical Structure
  83. GC18339 Amyloid β-Peptide (1-42) human

    Amyloid β-Peptide (1-42) human is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease.

    Amyloid β-Peptide (1-42) human Chemical Structure
  84. GP10057 Amyloid β-Peptide (10-20) (human) Amyloid β-Peptide (10-20) (human) Chemical Structure
  85. GP10094 Amyloid β-peptide (10-35), amide Amyloid β-peptide (10-35), amide Chemical Structure
  86. GP10097 Amyloid β-Protein (1-15) Amyloid β-Protein (1-15) Chemical Structure
  87. GC45382 Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt)   Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt) Chemical Structure
  88. GC42798 Amyloid-β (1-38) Peptide (trifluoroacetate salt) Amyloid-β (1-38) (Aβ38) peptide is a fragment of the Aβ42 peptide. Amyloid-β (1-38) Peptide (trifluoroacetate salt) Chemical Structure
  89. GC46850 Amyloid-β (1-40) Peptide (human) (trifluoroacetate salt) A neuropeptide with diverse biological activities Amyloid-β (1-40) Peptide (human) (trifluoroacetate salt) Chemical Structure
  90. GC46851 Amyloid-β (1-42) Peptide (trifluoroacetate salt) A 42-amino acid protein fragment of amyloid-β Amyloid-β (1-42) Peptide (trifluoroacetate salt) Chemical Structure
  91. GC42801 Amyloid-β (1-8) Peptide Amyloid-β (1-8) is a wild-type control for the mutation-containing amyloid-β (1-8, A2V) peptide . Amyloid-β (1-8) Peptide Chemical Structure
  92. GC42802 Amyloid-β (1-8, A2V) Peptide Amyloid-β (1-8, A2V) is a truncated form of amyloid-β (Aβ) that contains a valine to alanine substitution at position 2 of the Aβ numbering convention (Aβ A2V), which corresponds to position 673 of the amyloid precursor protein (APP) numbering convention (APP A673V). Amyloid-β (1-8, A2V) Peptide Chemical Structure
  93. GC42799 Amyloid-β (17-40) Peptide (human) (trifluoroacetate salt) Amyloid-β (Aβ) (17-40) is a 24-residue fragment of the Aβ protein that is formed via post-translational processing of amyloid precursor protein (APP) by α- and γ-secretases. Amyloid-β (17-40) Peptide (human) (trifluoroacetate salt) Chemical Structure
  94. GC42800 Amyloid-β (17-42) Peptide (human) (trifluoroacetate salt) Amyloid-β (Aβ) (17-42) is a 26-residue fragment of the Aβ protein that is formed via post-translational processing of amyloid precursor protein (APP) by α- and γ-secretases. Amyloid-β (17-42) Peptide (human) (trifluoroacetate salt) Chemical Structure
  95. GC40127 Amyloid-β (22-35) Peptide (trifluoroacetate salt) Amyloid-β (Aβ) (22-35) is a 13-residue fragment of Aβ that corresponds to residues 693-705 of the human amyloid precursor protein (APP) full-length sequence. Amyloid-β (22-35) Peptide (trifluoroacetate salt) Chemical Structure
  96. GC42803 Amyloid-β (25-35) Peptide (human) (trifluoroacetate salt) Amyloid-β (25-35) (Aβ (25-35)) is an 11-residue fragment of the Aβ protein that retains the physical and biological characteristics of the full length peptide. Amyloid-β (25-35) Peptide (human) (trifluoroacetate salt) Chemical Structure
  97. GC42804 Amyloid-β (40-1) Peptide (human) (trifluoroacetate salt) Amyloid-β (40-1) peptide (Aβ (40-1)) is a peptide that contains the reverse sequence of Aβ (1-40) peptide. Amyloid-β (40-1) Peptide (human) (trifluoroacetate salt) Chemical Structure
  98. GC40126 Amyloid-β Precursor Protein (96-110) Peptide (cyclized) (human) (trifluoroacetate salt) Amyloid-β precursor protein (96-110) peptide (cyclized) is a synthetic peptide consisting of amino acids 96-110 of amyloid precursor peptide (APP) that is cyclized via a bridge between the cysteine residues at positions 3 and 10. Amyloid-β Precursor Protein (96-110) Peptide (cyclized) (human) (trifluoroacetate salt) Chemical Structure
  99. GC34471 Angiogenin (108-122) TFA Angiogenin (108-122) TFA Chemical Structure
  100. GC32607 Angiogenin 108-122 أنجيوجينين 108-122 هو ببتيد أنجيوجينين. Angiogenin 108-122 Chemical Structure
  101. GC61479 Angiopep-2 hydrochloride Angiopep-2 هيدروكلوريد هو ناقل ببتيد في المخيمكن أن يؤدي اقتران العوامل المضادة للسرطان مع ناقل الببتيد Angiopep-2 إلى زيادة فعاليتها في علاج سرطان الدماغ Angiopep-2 hydrochloride Chemical Structure

عناصر 401 إلى 500 من مجموع 2065

لكل صفحة
  2. 3
  3. 4
  4. 5
  5. 6
  6. 7

تحديد الاتجاه التنازلي