Nesfatin-1 (30-59) (mouse, rat) |
Catalog No.GA23241 |
Nesfatin-1 (30-59), YDEYLKQVIEVLETDPHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. The mouse sequence differs in two positions from the human fragment.
Products are for research use only. Not for human use. We do not sell to patients.
Cas No.: 1872441-22-9
Sample solution is provided at 25 µL, 10mM.
Nesfatin-1 (30-59), YDEYLKQVIEVLETDPHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. The mouse sequence differs in two positions from the human fragment.
Average Rating: 5
(Based on Reviews and 1 reference(s) in Google Scholar.)GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *