Parstatin (human) |
Catalog No.GC11514 |
세포 투과성 PAR-1 트롬빈 수용체 작용제 펩티드인 파르스타틴(인간)은 혈관신생의 강력한 억제제입니다.
Products are for research use only. Not for human use. We do not sell to patients.
Cas No.: 1065755-99-8
Sample solution is provided at 25 µL, 10mM.
GlpBio Products Cited In Reputable Papers
Product Documents
Quality Control & SDS
- View current batch:
- Purity: >98.00%
- COA (Certificate Of Analysis)
- SDS (Safety Data Sheet)
- Datasheet
Cas No. | 1065755-99-8 | SDF | |
Canonical SMILES | CC(C[C@@](/N=C(O)/[C@](/N=C(O)/[C@](/N=C(O)/[C@]1([H])CCCN1C(C/N=C(O)/[C@](N)([H])CCSC)=O)([H])CCCNC(N)=N)([H])CCCNC(N)=N)([H])/C(O)=N/[C@@](/C(O)=N/[C@@](/C(O)=N/[C@@](/C(O)=N/[C@@](/C(O)=N/[C@@](/C(O)=N/[C@@](/C(O)=N/[C@@](/C(O)=N/[C@@](/C(O)=N/[C@@](/C | ||
Formula | C191H330N64O53S3 | M.Wt | 4467.29 |
Solubility | Soluble to 1 mg/ml in Water | Storage | Store at -20°C |
General tips | Please select the appropriate solvent to prepare the stock solution according to the
solubility of the product in different solvents; once the solution is prepared, please store it in
separate packages to avoid product failure caused by repeated freezing and thawing.Storage method
and period of the stock solution: When stored at -80°C, please use it within 6 months; when stored
at -20°C, please use it within 1 month. To increase solubility, heat the tube to 37°C and then oscillate in an ultrasonic bath for some time. |
||
Shipping Condition | Evaluation sample solution: shipped with blue ice. All other sizes available: with RT, or with Blue Ice upon request. |
Complete Stock Solution Preparation Table
Prepare stock solution | |||
1 mg | 5 mg | 10 mg | |
1 mM | 0.2238 mL | 1.1192 mL | 2.2385 mL |
5 mM | 0.0448 mL | 0.2238 mL | 0.4477 mL |
10 mM | 0.0224 mL | 0.1119 mL | 0.2238 mL |
In vivo Formulation Calculator (Clear solution)
Step 1: Enter information below (Recommended: An additional animal making an allowance for loss during the experiment)
Step 2: Enter the in vivo formulation (This is only the calculator, not formulation. Please contact us first if there is no in vivo formulation at the solubility Section.)
Calculation results:
Working concentration: mg/ml;
Method for preparing DMSO master liquid: mg drug pre-dissolved in μL DMSO ( Master liquid concentration mg/mL, Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug. )
Method for preparing in vivo formulation: Take μL DMSO master liquid, next addμL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O, mix and clarify.
Method for preparing in vivo formulation: Take μL DMSO master liquid, next add μL Corn oil, mix and clarify.
Note: 1. Please make sure the liquid is clear before adding the next solvent.
2. Be sure to add the solvent(s) in order. You must ensure that the solution obtained, in the previous addition, is a clear solution before proceeding to add the next solvent. Physical methods such as vortex, ultrasound or hot water bath can be used to aid dissolving.
3. All of the above co-solvents are available for purchase on the GlpBio website.
Related Products
- GC32992 7-Hydroxy-4-chromone (7-Hydroxychromone)
- GC34246 FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
- GC45939 N-3-oxo-decanoyl-L-Homoserine lactone
- GC32697 Methyl-β-cyclodextrin (Methyl-beta-cyclodextrin)
- GC35132 4-Hydroxylonchocarpin
- GC43224 Ceftazidime (hydrate)
- GC61779 Sephadex LH 20
- GC31506 SB-568849
- GC39120 Phthalic acid
- GC31875 CL656 (c-[2'FdAMP(S)-2'FdIMP(S)])
- GC13623 SDZ 21009
- GC39529 Dorzagliatin
- GC12174 FAK Inhibitor 14
- GC11435 ST 2825
- GC38039 Sigma-1 receptor antagonist 2
- GC17163 Elacridar hydrochloride
- GC37012 PROTAC MDM2 Degrader-3
리뷰
Average Rating: 5 ★★★★★ (Based on Reviews and 3 reference(s) in Google Scholar.)
GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *