다음의 검색결과: Peptide

카테고리: Caspase Aminopeptidase ACE Cathepsin HCV Protease MMP Thrombin Other Proteases Endogenous Metabolite Mitochondrial Metabolism PAI-1 Pyroptosis Bax Bcl-2 Family TNF-α Other Apoptosis PD-1/PD-L1 interaction Histone Acetyltransferases Histone Demethylases Histone Methyltransferase Citrullination Histones/Histone Peptides Sterol Biosynthesis Neuronal Metabolism Bone Growth & Remodeling Carbohydrate Metabolism Cofactors & Vitamins Dyslipidemias Metabolic Syndrome Necrosis Nutrient Sensing Reproductive Biology ERK PKA p38 JNK cAMP Broad Spectrum Protein Kinase Inhibitor EGFR Insulin Receptor Src Trk ATM/ATR CDK DNA/RNA Synthesis Casein Kinase AMPK GSK-3 S6 Kinase Antibiotic HBV HCV HIV Antifungal Bacterial Fungal Parasite Coronaviruses Entry/Fusion Inhibitors COVID-19 Antiviral Microtubule/Tubulin Dynamin ECM & Adhesion Molecules Endomembrane System & Vesicular Trafficking Proteolysis Cytoskeleton & Motor Proteins Autophagy STAT PKC Integrin PAR1 Neuropeptide FF/AF Receptors Formyl Peptide Receptors 5-HT Receptor Adrenergic Receptor Apelin Receptor Angiotensin Receptor Bombesin Receptors Bradykinin Receptors Calcitonin and Related Receptors Cannabinoid Receptor CaSR CCR Chemokine Receptors Endothelin Receptor Galanin Receptors Ghrelin Receptors GIP Receptor Glucagon Receptor Melanocortin (MC) Receptors Motilin Receptor Non-selective CRF Neurotensin Receptors NOP Receptor NPY Receptors Oxytocin Receptors Peptide Receptors Protease-Activated Receptors Secretin Receptors Urotensin-II Receptor VIP Receptors Neuromedin U Receptors mAChR Neurokinin Receptor GCGR GLP Receptor YAP AMPAR Calcium Channel Pannexin-1 TRP Channel Kainate Receptors Na+/K+ ATPase Cancer Biology Peptides Tumor Microenvironment Cell Migration & Metastasis GnRH Opioid Receptor Thyroid hormone Receptor TRH Glucocorticoids & Mineralocorticoids AChR Alzheimer Amyloid β CGRP DAPK Gap Junction GluR Histamine Receptor Neuroscience Peptides CaMK Behavioral Neuroscience Neuroendocrinology Neuroprotection Ophthalmology Pain Research Parkinson Seizure Disorders Prion Diabetes NAFLD & NASH Obesity Other Signal Transduction Apoptosis NF-κB Complement System IFNAR NOD-like Receptor (NLR) STING Reactive Oxygen Species Glutathione Adaptive Immunity Allergy Arthritis Autoimmunity Gastric Disease Innate Immunity Pulmonary Diseases PSMA Acute Phase Reactants Arrhythmia Atherosclerosis Chronic Kidney Disease Coagulation & Hemostasis Diabetic Nephropathy Endothelium Erythrocytes & Hemoglobin Heart Failure Hypertension Hypotension Myocardial Contractility Myocardial Hypertrophy Myocardial Infarction Serum Proteins Smooth Muscle Cells Stroke Thrombosis Vasoconstriction Vasodilation Antioxidants Carbohydrate Oxidation Lipid Peroxidation Pro-Oxidant Activity Inhibitory Antibodies Adenylate cyclase Cell Penetrating Peptide Cytokine Enzyme Substrates / Activators Fluorescent Probes Glycoprotein Guanylate Cyclase MDR multidrug resistance Myosin Natriuretic Peptide Receptors Nitric Oxide Renin Tachykinin Transcription Factors Others Cyclase Negative Controls Toxicology Antiparasitics Toxins Peptide Coupling Reagents Amino Acids and Derivatives Natural Products Cyanine Dyes Affinity Probes Dyes, Stains & Indicators Enzyme Substrates Fluorescence Biochemical Assay Reagents Tag Peptides Amyloid β protein Neuropeptides Peptide Hormones Inhibitors and Substrates Peptide Epitopes Peptides for Drug Delivery Click Chemistry reagents Dengue Yellow Fever Food-Borne Illnesses MRSA Pneumonia STDs Tuberculosis Candidiasis Leishmaniasis Quorum Sensing Macrophage Migration Inhibitory Factor Superoxide Dismutase

Cat.No. 상품명 정보
GC31523 Peptide YY (PYY) (3-36), human (Peptide YY (3-36)) 펩타이드 YY(PYY)(3-36), 인간(Peptide YY(3-36))은 식욕을 감소시키는 Y2 수용체 작용제로 작용하는 장 호르몬 펩타이드입니다.
GC44598 Peptide YY (human) (trifluoroacetate salt)

Peptide Tyrosine Tyrosine

Peptide YY (PYY) is a 36-amino acid peptide and anorectic gut hormone agonist for the neuropeptide Y receptors Y1, Y2, Y5, and Y6 with EC50 values of 0.7, 0.58, 1, and 0.8 nM, respectively, for supression of forskolin-induced cAMP accumulation.
GC63855 Peptide YY (PYY) (3-36), porcine TFA 펩타이드 YY(PYY)(3-36), 돼지 TFA는 식욕을 감소시키는 Y2 수용체 작용제로 작용하는 장 호르몬 펩타이드입니다.
GC36874 Peptide YY (PYY) (3-36), human TFA
GC72259 Peptide A5K Peptide A5K (INF7-A5K-TAT)는 크리스퍼 RNP를 T 세포로 전달하는 RNP 배달 펩타이드입니다.
GC72139 Peptide5 TFA Peptide5 TFA, 커넥신 43 모방 펩타이드는 동물의 부종, 천체교증, 척수 손상 후 신경세포 사멸을 감소시킨다.
GC32335 Peptide T TFA 펩티드 T(TFA)는 HIV-1 gp120의 V2 영역의 옥타펩티드입니다.
GC32309 Peptide T 펩티드 T는 HIV-1 gp120의 V2 영역의 옥타펩티드입니다.
GC31767 Peptide 401 봉독의 강력한 비만세포 탈과립 인자인 펩티드 401은 다양한 평활근 경련제(히스타민, 5-HT)의 피내 주사로 인해 증가된 혈관 투과성을 억제합니다.
GC30452 Peptide YY (PYY), human

Peptide Tyrosine Tyrosine
펩타이드 YY(PYY)는 식욕을 조절하고 췌장 분비를 억제하는 장 호르몬입니다.
GC36873 Peptide C105Y α1-항트립신의 잔기 359-374에 해당하는 아미노산 서열을 기반으로 하는 합성 및 세포 투과성 펩티드인 펩티드 C105Y는 DNA 나노입자의 유전자 발현을 향상시킵니다.
GC52502 Peptide YY (3-36) (trifluoroacetate salt)

Pancreatic Peptide YY, Peptide Tyrosine Tyrosine
A satiety hormone
GA23355 Peptide Lv (rat) Peptide Lv has been discovered via a computational bioinformatics-based screening process. The neuropeptide is expressed in retinal photoreceptor layer, hippocampus, olfactory bulb, cerebellum, cerebral cortex, lung, spleen, liver and intestine. Peptide Lv enhances L-type voltage-gated calcium channel (L-VGCC) currents in retinal photoreceptors.
GC63347 Peptide 78 펩티드 78, 화학주성 사이토카인, IL-8 또는 C-X-C 케모카인 슈퍼유전자 패밀리의 78개 아미노산 단백질 구성원.
GC63141 Peptide 74 펩타이드 74는 MMP(matrix metalloproteinase)의 프로도메인 서열을 포함하는 합성 펩타이드입니다. 펩티드 74는 시험관 내에서 72-kDa 유형 IV 콜라게나제의 활성화된 형태를 억제합니다.
GC30233 Peptide M 펩티드 M은 합성 아미노산(소 S-항원: DTNLASSTIIKEGIDKTV의 아미노산 위치 303-322에 해당하는 길이 18개 아미노산)으로 원숭이 및 하틀리 기니피그 및 루이스 래트에서 실험적 자가면역 포도막염을 유도할 수 있습니다. .
GP10131 Peptide YY(3-36), PYY, human
GA23356 Peptide WE-14 WE-14, a chromogranin A-derived peptide, was isolated from a human ileal carcinoid tumor. Its sequence WSKMDQLAKELTAE is highly conserved in many mammalian species and flanked by typical processing sites. Such factors would indicate a potential physiological role for peptide WE-14.
GA23357 Peptide YY (13-36) (canine, mouse, porcine, rat) This C-terminal fragment was shown to suppress the noradrenaline release from sympathetic nerve endings. It thereby mimics the effects of PYY and NPY at presynaptic (Y?) receptors. The peptide was also able to compete with NPY for essentially all binding sites in rat brain.
GA23358 Peptide YY (canine, mouse, porcine, rat)
GC50439 Peptide5 connexin 43 모방 펩티드인 Peptide5는 척수 손상 후 동물의 부종, 성상교세포증 및 신경 세포 사멸을 감소시킵니다.
GC30535 Transdermal Peptide (TD 1 (peptide)) Transdermal Peptide (TD 1 (peptide))는 11개의 아미노산으로 구성되어 있으며, 세포 표시를 통한 첫 번째 투피질 강화 펩타이드로 발견되었다.
GC31527 C-Peptide, dog (C-Peptide (dog))

C-Peptide (dog)
C-Peptide, dog(C-Peptide(dog))은 프로인슐린의 성분으로 췌장 베타세포에서 인슐린과 함께 혈액으로 방출됩니다.
GC31172 δ-Sleep Inducing Peptide (Delta-Sleep Inducing Peptide) δ-수면 유도 펩티드(Delta-Sleep Inducing Peptide)는 항산화 및 항불안 특성을 지닌 신경 펩티드입니다.
GC34397 Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) Sphistin Synthetic Peptide(12-38, Fitc in N-Terminal-Fluorescently Labeled Peptide)는 강력한 항균 활성을 나타내는 Sphistin Synthetic Peptide의 잘린 단편입니다.
GP10149 3X FLAG Peptide

H-Met-Asp-Tyr-Lys-Asp-His-Asp-Gly-Asp-Tyr-Lys-Asp-His-Asp-Ile-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-OH
3X FLAG Peptide는 DYKXXD 아미노산 시퀀스를 세 번 반복한 합성 폴리펩타이드로, 일반적으로 앤티플래그 항체와 경쟁적으로 결합하는 데 사용된다.
GP10150 FLAG tag Peptide

H-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-OH
FLAG tag Peptide는 장 소화효소 제한 사이트를 포함하는 8-peptide이다 (Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Asp-Lys).
GC30285 Eledoisin (Eledone peptide)

ELD 950, Moschatin
A neurokinin receptor agonist
GP10155 S Tag Peptide
S 태그는 췌장 리보누클레아제 A (RNase A)에서 유래된 올리고펩타이드의 이름입니다.
GC45382 Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt)

Aβ (1-28), Aβ28
GP10082 Amyloid Beta-peptide (25-35) (human) Amyloid Beta-peptide (25-35) (human)은 신경 독성 효과가 있는 알츠하이머 아밀로이드 베타 펩타이드의 일부이다.
GC52376 BMP2-derived Peptide (trifluoroacetate salt)

Bone Morphogenic Protein 2-derived Peptide, KIPKASSVPTELSAISTLYL-NH2
A synthetic peptide
GC44655 PKCε Inhibitor Peptide

Protein Kinase Cɛ Inhibitor Peptide，ɛV1-2
PKCε Inhibitor Peptide, εV1-2라고도 불리는 것은 프로틴 킨아즈 C ε(PKCε)에서 유래된 peptide로, 선택적 PKCε 억제제로 작용하며 PKCε의 이동을 억제한다.
GC91860 Glucose-dependent Insulinotropic Peptide (22-51) (human) (trifluoroacetate salt)

GIP (22-51),Gastric Inhibitory Peptide (22-51)
Glucose-dependent insulinotropic peptide (GIP) (22-51) is a pro-atherogenic 30-amino acid peptide corresponding to residues 22-51 of the GIP precursor protein proGIP that has been found in human plasma.
GC91854 RS Repeat Peptide (trifluoroacetate salt) RS repeat peptide is a serine/arginine-rich peptide substrate for CDC-like kinase 1 (Clk1).
GC91847 KEMPFPKYPVEP Peptide (bovine, ovine) (trifluoroacetate salt) KEMPFPKYPVEP Peptide is a peptide fragment of the dairy protein β-casein.
GC91835 Heparin-binding Peptide (trifluoroacetate salt)

Fibronectin Adhesion-promoting Peptide,Fibronectin Peptide V,FN-C/H-V
Heparin-binding peptide is a synthetic peptide fragment corresponding to residues 1,892-1,899 of the C-terminal heparin-binding domain of fibronectin.
GP10091 Vasonatrin Peptide (1-27)

H2N-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH
Vasonatrin Peptide (1-27), (C124H198N36O36S3), a peptide with the sequence H2N-GLSKGCFGLKLDRIGSMSGLGCNSFRY-OH, MW= 2865.4.
GC52385 Myelin Basic Protein (85-99) Peptide Antagonist (trifluoroacetate salt)

EKPKVEAYKAAAAPA-OH, MBP (85-99) Peptide Antagonist
An MBP (85-99) antagonist
GC66061 Competence-Stimulating Peptide-2 (CSP-2) Competence-Stimulating Peptide-2(CSP-2)는 Streptococcus pneumoniae에 의해 생산되는 정족수 감지 신호 펩티드입니다. 821d96072c2d58d8970e76f526b0f6b8ComD2는 EC50 값이 50.7nM인 Competence-Stimulating Peptide-2(CSP-2)의 호환 가능한 수용체입니다.821d96072c2d58d8970e76f526b0f6b8
GC35432 Autocamtide-2-related inhibitory peptide (TFA)
GC92117 RVG Peptide (trifluoroacetate salt)

Rabies Virus Glycoprotein; Rabies Virus Glycoprotein 29; RABV-G; RVG29
RVG Peptide (trifluoroacetate salt)은 니코틴형 아세틸콜린 수용체(nAChR) 옹색제(인간 수용체에 대한 IC50=2.5μM)의 일종이다.
GC74301 FLAG peptide TFA FLAG peptide TFA는 플래그 펩타이드의 TFA 소금 형태입니다.
GC91844 [pGlu4]-Myelin Basic Protein Peptide (trifluoroacetate salt)

pGlu4-MBP Peptide
[pGlu]-Myelin basic protein peptide is a substrate for PKC.
GC90546 MOG Peptide (human, bovine) (acetate)
내생성 미엘린 실 peptide
GP10118 Amyloid Beta-Peptide (1-40) (human)
인간 Amyloid β-Peptide (1-40) (C194H295N53O58S1)은 H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH 시퀀스를 가진 펩타이드로, 분자량은 4329.8입니다. 아밀로이드 베타(Aβ 또는 Abeta)는 아밀로이드 전구 단백질에서 처리된 36~43개의 아미노산으로 이루어진 펩타이드입니다.
GP10049 Amyloid Beta-Peptide (12-28) (human) Amyloid Beta-Peptide (12-28) (human)은 아밀로이드 베타 단백질 (1-42) (Aβ (1-42))의 펩타이드 조각이다.
GC52361 AMARA Peptide (trifluoroacetate salt)

AMARAASAAALARRR-OH, H-Ala-Met-Ala-Arg-Ala-Ala-Ser-Ala-Ala-Ala-Leu-Ala-Arg-Arg-Arg-OH
A peptide substrate for AMPK
GC52196 RGD Peptide

GRGDNP, HGlyArgGlyAspAsnProOH
RGD Peptide는 인테그린-리간드 상호작용의 억제제로 작용하며 세포 접착, 이동, 성장 및 분화에 중요한 역할을 합니다.
GC49883 DAPK Substrate Peptide (trifluoroacetate salt)

Death-associated Protein Kinase Substrate Peptide
A DAPK1 peptide substrate
GC48346 DYKDDDDK Peptide (trifluoroacetate salt)

DYKDDDDK Epitope, DYKDDDDK Octapeptide, DYKDDDDK Tag
GC37524 RGD peptide (GRGDNP) TFA
GC35123 3X FLAG peptide TFA
GC44806 Ras Inhibitory Peptide

Sos SH3 Domain Inhibitor
Son of sevenless homolog 1 (Sos1) is a guanine nucleotide exchange factor (GEF) that directs the exchange of Ras-GDP to Ras-GTP by binding to SH3 domains of the growth factor receptor-bound protein 2 (Grb2), leading to the activation of ERK.
GC34274 SPACE peptide SPACE 펩타이드는 피부 투과 펩타이드(SPP)입니다.
GC32787 iRGD peptide (c(CRGDKGPDC))

c(CRGDKGPDC)
iRGD 펩타이드(c(CRGDKGPDC))는 9-아미노산 고리형 펩타이드로, 먼저 av 인테그린에 결합한 다음 종양에서 단백질 분해로 절단되어 뉴로필린-1과 상호작용하는 CRGDK/R을 생성함으로써 약물의 조직 침투를 유발하고 종양이 있습니다. - 표적화 및 종양 투과성.
GC91470 Fyn Peptide (410-430) (human, mouse, rat, porcine, bovine) (trifluoroacetate salt)

Src (409-429) (human, rat); Src (408-428) (mouse)

Fyn 펩타이드 (410-430)는 Tyr420을 포함하는 Src 패밀리 비수용체 티로신 키나제 Fyn의 펩타이드 단편입니다. 이는 전체 Fyn 활성화 시 자가인산화를 겪습니다.
GC91462 Abl Substrate Peptide (trifluoroacetate salt)
Abl 기질 펩타이드는 타이로신 키나제 Abl을 위한 펩타이드 기질입니다.
GC91441 RGD Peptide (trifluoroacetate salt)

GRGDNP; H-Gly-Arg-Gly-Asp-Asn-Pro-OH

RGD 펩타이드는 아르기닌-글리신-아스파트산 모티브로 구성된 합성 화합물로, 세포 접착, 이동, 성장 및 분화와 관련된 연구에서 인테그린-리간드 상호작용을 억제하는 데 광범위하게 사용되었습니다.
GC91027 EGFRvIII Peptide (trifluoroacetate salt)
EGFRvIII 펩타이드 단편
GC90733 Klotho-derived Peptide 1 (56-87) (human) (trifluoroacetate salt)
TGF-β 억제 펩타이드
GC90635 RAD17-derived Peptide (trifluoroacetate salt)
ATR을 위한 펩타이드 기질
GC90620 N-Peptide (trifluoroacetate salt)
펩타이드
GC90600 Tat-NTS Peptide (trifluoroacetate salt)
세포 침투 펩타이드
GC90561 Gastric Inhibitory Peptide (22-51) (human) (trifluoroacetate salt)
동맥경화를 촉진하는 펩타이드
GC90558 Myelin Basic Protein Peptide Antagonist (trifluoroacetate salt)
MBP (Myelin Basic Protein) 억제제
GC90547 Gastric Inhibitory Peptide 1 (3-42) (human) (trifluoroacetate salt)
GIP의 펩타이드 단편과 GIP 수용체 억제제
GC90543 EGFR Peptide (human, mouse) (myristoylated) (trifluoroacetate salt)
PKC 억제제
GC90542 EGFR Peptide (human, mouse) (trifluoroacetate salt)
PKC의 펩타이드 기질
GC90534 Gastric Inhibitory Peptide (1-39) (porcine) (trifluoroacetate salt)
인슐린 분비 유도제
GC90529 Myelin Basic Protein Peptide (mouse, bovine) (trifluoroacetate salt)
PKC를 위한 펩타이드 기질
GC90286 Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt)
28개의 아미로이드-β 단백질 조각
GC70187 δ-Sleep Inducing Peptide acetate

Delta-Sleep Inducing Peptide acetate

δ-수면 유도 펩타이드 아세테이트는 신경 펩타이드로, 항산화 및 항불안 작용을 가지고 있습니다.
GC17195 Bax inhibitor peptide V5

BIP-V5; BAX Inhibiting Peptide V5
A Bax inhibitor
GP10104 S6 Kinase Substrate Peptide 32

H2N-Lys-Glu-Ala-Lys-Glu-Lys-Arg-Gln-Glu-Gln-Ile-Ala-Lys-Arg-Arg-Arg-Leu-Ser-Ser-Leu-Arg-Ala-Ser-Thr-Ser-Lys-Ser-Gly-Gly-Ser-Gln-Lys-OH
Measures the activity of kinases that phosphorylate ribosomal protein S6.
GP10108 EGF-R (661-681) T669 Peptide

H2N-Lys-Arg-Glu-Leu-Val-Glu-Pro-Leu-Thr-Pro-Ser-Gly-Glu-Ala-Pro-Asn-Gln-Ala-Leu-Leu-Arg-OH
GP10011 Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell

Ac-Pro-Tyr-Asn-Ser-Ser-Pro-Arg-Pro-Glu-Gln-His-Lys-Ser-Tyr-Lys-Cys-OH
GP10098 Cdk2/Cyclin Inhibitory Peptide I

H2N-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Pro-Val-Lys-Arg-Arg-Leu-Phe-Gly-OH
GP10094 Amyloid β-peptide (10-35), amide

H2N-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-NH2
GP10147 Ribosomal protein L3 peptide (202-222) amide

H2N-Met-Ser-His-Arg-Lys-Tyr-Glu-Ala-Pro-Arg-His-Gly-His-Leu-Gly-Phe-Leu-Pro-Arg-Lys-Arg-amide
GP10042 Rhodopsin peptide

H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH
GP10127 Cadherin Peptide, avian

H2N-Leu-Arg-Ala-His-Ala-Val-Asp-Val-Asn-Gly-amide

Role in cell adhesion
GP10095 Epidermal Growth Factor Receptor Peptide (985-996)

H2N-Asp-Val-Val-Asp-Ala-Asp-Glu-Tyr-Leu-Ile-Pro-Gln-OH
GP10089 Platelet Membrane Glycoprotein IIB Peptide (296-306)

H2N-Thr-Asp-Val-Asn-Gly-Asp-Gly-Arg-His-Asp-Leu-OH

Inhibits platelet aggregation
GP10046 Amyloid Precursor C-Terminal Peptide

H2N-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH

For beta amyloid generation
GP10022 Dynamin inhibitory peptide

Gln-Val-Pro-Ser-Arg-Pro-Asn-Arg-Ala-Pro
GA21428 Erythropoietin Mimetic Peptide Sequence 20 Peptide mimetic of erythropoietin (EPO). EMP-20 has been described to be an excellent starting point for the design of compounds with erythropoietin (EPO) mimetic activity and can serve as a minimal model for an EPO receptor antagonist.
GC26590 Hexokinase II VDAC binding domain peptide, cell-permeable

Hxk2VBD peptide;cell-permeable

Hexokinase II VDAC binding domain peptide (Hxk2VBD peptide) is a cell-permeable hexokinase II VDAC binding domain. Hexokinase II VDAC binding domain peptide inhibits mitochondrial localization of hexokinase 2 (HXK2). Hexokinase II VDAC binding domain peptide inhibits neurotrophic factor-directed axon outgrowth.
GC62069 pm26TGF-β1 peptide TFA
GC62068 pm26TGF-β1 peptide
GC26392 MANS peptide TFA
MANS peptide TFA is the TFA salt form of MANS peptide. MANS peptide TFA is an inhibitor of MARCKS, which competitively binds to MARCKS on the cell membrane, thereby inhibiting mucin secretion and tumor metastasis.
GA23574 SV40 Nuclear Transport Signal Peptide Analog NLS, cell-penetrating peptide containing 7 amino acids homologous to the SV40 T antigen, was capable of inducing the transport of several carrier proteins to the nucleus. The terminal cysteine permits the attachment of this peptide to any protein using a heterobifunctional crosslinking reagent. Coupling to plasmid DNA has also been realized by M.G.SebastyÉn and coworkers. Heterodimerization of TAT and NLS yields an even more effective transfecting peptide.
GC35334 Amyloid β Peptide (42-1)(human) 아밀로이드 β 펩티드(42-1)(인간)는 아밀로이드 β의 비활성 형태입니다. 펩티드(1-42).
GC10693 c-JUN peptide JNK/c-Jun interaction inhibitor
GC26088 YAP-TEAD Inhibitor 1 (Peptide 17) YAP-TEAD Inhibitor 1 (Peptide 17) is a YAP-TEAD protein-protein interaction inhibitor which has potential usage in treatment of YAP-involved cancers with IC50 of 25 nM.
GC64248 c-Myc Peptide TFA c-Myc Peptide(TFA)는 인간 c-myc 단백질의 C-말단 아미노산(410-419)에 해당하는 합성 펩타이드로, 성장 관련 유전자 전사 조절에 관여합니다.
GC63708 Uty HY Peptide (246-254) (TFA) Uty HY Peptide (246-254) TFA는 Y 염색체(UTY) 단백질의 유비쿼터스 전사된 테트라트리코펩티드 반복 유전자에서 H-Y 에피토프인 H-YDb로 남성 특이적 이식 항원 H-Y입니다.
GC61345 Transdermal Peptide Disulfide TFA

TD 1 Disulfide(peptide) TFA
Transdermal Peptide Disulfide TFA(TD 1 Disulfide(peptide) TFA)는 11개의 아미노산으로 구성된 펩타이드로 Na+/K+-ATPase beta-subunit(ATP1B1)에 결합하며 주로 C-말단과 상호작용합니다. ATP1B1.
GC60095 Brain Natriuretic Peptide (1-32), rat acetate

BNP (1-32), rat acetate
Brain Natriuretic Peptide(1-32), rat acetate(BNP(1-32), rat acetate)는 심장근육세포(cardiomyocytes)의 과도한 스트레칭에 대한 반응으로 심장의 심실에서 분비되는 32개 아미노산의 폴리펩타이드입니다. .
GC36150 Glucagon-Like Peptide (GLP) I (7-36), amide, human Glucagon-Like Peptide (GLP) I (7-36), amide, human은 인슐린 분비를 자극하는 생리학적 인크레틴 호르몬입니다.

Products for 카테고리