Suchergebnisse für "Peptide"

Kategorie: Caspase Aminopeptidase ACE Cathepsin Elastase HCV Protease MMP Thrombin Other Proteases Endogenous Metabolite Mitochondrial Metabolism Pyroptosis Bax Bcl-2 Family p53 TNF-α Other Apoptosis PD-1/PD-L1 interaction Histone Acetyltransferases Histone Demethylases Histone Methyltransferase Epigenetic Reader Domain Citrullination Histones/Histone Peptides Sterol Biosynthesis Neuronal Metabolism Bone Growth & Remodeling Carbohydrate Metabolism Cofactors & Vitamins Dyslipidemias Metabolic Syndrome Necrosis Nutrient Sensing Reproductive Biology PKA p38 JNK cAMP Broad Spectrum Protein Kinase Inhibitor EGFR Insulin Receptor Src Trk ATM/ATR CDK DNA/RNA Synthesis Casein Kinase AMPK GSK-3 S6 Kinase Antibiotic HBV HCV HIV Antifungal Arenavirus Bacterial Parasite Coronaviruses Entry/Fusion Inhibitors COVID-19 Antiviral Microtubule/Tubulin Dynamin ECM & Adhesion Molecules Endomembrane System & Vesicular Trafficking Proteolysis Cytoskeleton & Motor Proteins Autophagy STAT PKC Integrin PAR1 Neuropeptide FF/AF Receptors Formyl Peptide Receptors 5-HT Receptor Adrenergic Receptor Apelin Receptor Angiotensin Receptor Bombesin Receptors Bradykinin Receptors Calcitonin and Related Receptors Cannabinoid Receptor CaSR CCR Chemokine Receptors Endothelin Receptor Galanin Receptors Ghrelin Receptors GIP Receptor Glucagon Receptor Melanocortin (MC) Receptors Motilin Receptor Non-selective CRF Neurotensin Receptors NOP Receptor NPY Receptors Oxytocin Receptors Peptide Receptors Protease-Activated Receptors Secretin Receptors Vasopressin Receptor Urotensin-II Receptor VIP Receptors Neuromedin U Receptors mAChR Neurokinin Receptor YAP AMPAR Calcium Channel Pannexin-1 Potassium Channel TRP Channel Kainate Receptors Na+/K+ ATPase Cancer Biology Peptides Tumor Microenvironment Cell Migration & Metastasis GnRH Opioid Receptor Thyroid hormone Receptor TRH Glucocorticoids & Mineralocorticoids AChR Alzheimer Amyloid β CGRP DAPK Gap Junction GluR Histamine Receptor Neuroscience Peptides CaMK Behavioral Neuroscience Neuroendocrinology Neuroprotection Ophthalmology Pain Research Parkinson Seizure Disorders Prion Diabetes NAFLD & NASH Obesity Other Signal Transduction Apoptosis NF-κB Complement System IFNAR NOD-like Receptor (NLR) STING Reactive Oxygen Species Glutathione Adaptive Immunity Allergy Arthritis Autoimmunity Gastric Disease Innate Immunity Pulmonary Diseases PSMA Acute Phase Reactants Arrhythmia Atherosclerosis Chronic Kidney Disease Coagulation & Hemostasis Diabetic Nephropathy Endothelium Erythrocytes & Hemoglobin Heart Failure Hypertension Hypotension Myocardial Contractility Myocardial Hypertrophy Myocardial Infarction Serum Proteins Smooth Muscle Cells Stroke Thrombosis Vasoconstriction Vasodilation Antioxidants Carbohydrate Oxidation Lipid Peroxidation Pro-Oxidant Activity Inhibitory Antibodies Adenylate cyclase Cell Penetrating Peptide Cytokine Enzyme Substrates / Activators Fluorescent Probes Glycoprotein Guanylate Cyclase MDR multidrug resistance Myosin Natriuretic Peptide Receptors Nitric Oxide Renin Tachykinin Transcription Factors Others Cyclase Negative Controls Toxicology Antiparasitics Toxins Peptide Coupling Reagents Amino Acids and Derivatives Other Resin and Derivatives Natural Products Cyanine Dyes Affinity Probes Fluorescent Dye Enzyme Substrates Fluorescence Biochemical Assay Reagents Tag Peptides Amyloid β protein Neuropeptides Peptide Hormones Inhibitors and Substrates Peptide Epitopes Peptides for Drug Delivery Click Chemistry reagents Dengue Yellow Fever Food-Borne Illnesses MRSA Pneumonia STDs Tuberculosis Candidiasis Leishmaniasis Quorum Sensing Macrophage Migration Inhibitory Factor Superoxide Dismutase

Bestell-Nr. Artikelname Informationen
GC31523 Peptide YY (PYY) (3-36), human (Peptide YY (3-36)) Peptid YY (PYY) (3-36), human (Peptid YY (3-36)) ist ein Darmhormonpeptid, das als Y2-Rezeptoragonist wirkt, um den Appetit zu reduzieren.
GC44598 Peptide YY (human) (trifluoroacetate salt)

Peptide Tyrosine Tyrosine

Peptide YY (PYY) is a 36-amino acid peptide and anorectic gut hormone agonist for the neuropeptide Y receptors Y1, Y2, Y5, and Y6 with EC50 values of 0.7, 0.58, 1, and 0.8 nM, respectively, for supression of forskolin-induced cAMP accumulation.
GC63855 Peptide YY (PYY) (3-36), porcine TFA Peptid YY (PYY) (3-36), Schweine-TFA ist ein Darmhormonpeptid, das als Y2-Rezeptoragonist wirkt, um den Appetit zu reduzieren.
GC36874 Peptide YY (PYY) (3-36), human TFA
GC72259 Peptide A5K Peptide A5K (INF7-A5K-TAT) ist ein RNP-Lieferpeptid, das CRISPR-RNPs an T-Zellen abgibt.
GC72139 Peptide5 TFA Peptide5 TFA, ein connexin 43 mimetisches Peptid, reduziert Schwellungen von Tieren, Astrogliose und neuronalen Zelltod nach Rückenmarksverletzung.
GC32335 Peptide T TFA Peptid T (TFA) ist ein Octapeptid aus der V2-Region von HIV-1 gp120.
GC32309 Peptide T Peptid T ist ein Octapeptid aus der V2-Region von HIV-1 gp120.
GC31767 Peptide 401 Peptid 401, ein starker Mastzell-Degranulationsfaktor aus Bienengift, unterdrÜckt die erhÖhte GefÄßpermeabilitÄt aufgrund der intradermalen Injektion verschiedener Spasmogene der glatten Muskulatur (Histamin und 5-HT).
GC30452 Peptide YY (PYY), human

Peptide Tyrosine Tyrosine
Peptid YY (PYY) ist ein Darmhormon, das den Appetit reguliert und die Sekretion der BauchspeicheldrÜse hemmt.
GC36873 Peptide C105Y Peptid C105Y, ein synthetisches und zellgÄngiges Peptid, das auf der AminosÄuresequenz basiert, die den Resten 359-374 von α1-Antitrypsin entspricht, verstÄrkt die Genexpression von DNA-Nanopartikeln.
GC52502 Peptide YY (3-36) (trifluoroacetate salt)

Pancreatic Peptide YY, Peptide Tyrosine Tyrosine
A satiety hormone
GA23355 Peptide Lv (rat) Peptide Lv has been discovered via a computational bioinformatics-based screening process. The neuropeptide is expressed in retinal photoreceptor layer, hippocampus, olfactory bulb, cerebellum, cerebral cortex, lung, spleen, liver and intestine. Peptide Lv enhances L-type voltage-gated calcium channel (L-VGCC) currents in retinal photoreceptors.
GC63347 Peptide 78 Peptid 78, ein chemotaktisches Zytokin, ein 78 AminosÄuren langes Proteinmitglied der IL-8- oder C-X-C-Chemokin-Supergenfamilie.
GC63141 Peptide 74 Peptid 74 ist ein synthetisches Peptid, das die ProdomÄnensequenz von Matrixmetalloproteinase (MMP) enthÄlt. Peptid 74 hemmt die aktivierte Form der 72-kDa-Typ-IV-Kollagenase in vitro.
GC30233 Peptide M Peptid M ist eine synthetische AminosÄure (18 AminosÄuren lang, die den AminosÄurepositionen 303-322 des Rinder-S-Antigens entsprechen: DTNLASSTIIKEGIDKTV), die in der Lage ist, experimentelle Autoimmun-Uveitis bei Affen und Hartley-Meerschweinchen sowie Lewis-Ratten zu induzieren .
GP10131 Peptide YY(3-36), PYY, human
GA23356 Peptide WE-14 WE-14, a chromogranin A-derived peptide, was isolated from a human ileal carcinoid tumor. Its sequence WSKMDQLAKELTAE is highly conserved in many mammalian species and flanked by typical processing sites. Such factors would indicate a potential physiological role for peptide WE-14.
GA23357 Peptide YY (13-36) (canine, mouse, porcine, rat) This C-terminal fragment was shown to suppress the noradrenaline release from sympathetic nerve endings. It thereby mimics the effects of PYY and NPY at presynaptic (Y?) receptors. The peptide was also able to compete with NPY for essentially all binding sites in rat brain.
GA23358 Peptide YY (canine, mouse, porcine, rat)
GC50439 Peptide5 Peptid5, ein Connexin 43-mimetisches Peptid, reduziert Schwellungen, Astrogliose und neuronalen Zelltod nach einer RÜckenmarksverletzung bei TierenIn Vitro: Peptid5 reduziert signifikant den Grad der RÜckenmarksverletzung (SCI) in einem Nagetier-Ex-vivo-Modell.
GC30535 Transdermal Peptide (TD 1 (peptide)) Transdermal Peptide (TD 1 (peptide)), bestehend aus 11 Aminosäuren, ist das erste transdermale verstärkende Peptid, das durch Phagendisplay entdeckt wurde.
GC31172 δ-Sleep Inducing Peptide (Delta-Sleep Inducing Peptide) δ-Sleep Inducing Peptide (Delta-Sleep Inducing Peptide) ist ein Neuropeptid mit antioxidativen und anxiolytischen Eigenschaften.
GC31527 C-Peptide, dog (C-Peptide (dog))

C-Peptide (dog)
C-Peptid, Hund (C-Peptid (Hund)) ist ein Bestandteil von Proinsulin, das zusammen mit Insulin aus Betazellen der BauchspeicheldrÜse ins Blut freigesetzt wird.
GC34397 Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) Synthetisches Sphistin-Peptid (12-38, Fitc in N-terminal fluoreszierend markiertem Peptid) ist ein verkÜrztes Fragment des synthetischen Sphistin-Peptids, das eine starke antimikrobielle AktivitÄt zeigt.
GP10149 3X FLAG Peptide

H-Met-Asp-Tyr-Lys-Asp-His-Asp-Gly-Asp-Tyr-Lys-Asp-His-Asp-Ile-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-OH

Synthetisches Peptid-Tag
GP10150 FLAG tag Peptide

H-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-OH
FLAG tag Peptide ist ein 8-Peptid (Asp-Tyr-Lys-Asp-Asp-Asp-ASP-ASP-Lys), das eine intestinale Kinase-Beschränkungsstelle enthält.
GC30285 Eledoisin (Eledone peptide)

ELD 950, Moschatin
A neurokinin receptor agonist
GP10155 S Tag Peptide
S Tag ist der Name eines Oligopeptids, das aus pankreatischem Ribonuklease A (RNase A) abgeleitet wird.
GC45382 Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt)

Aβ (1-28), Aβ28
GC52376 BMP2-derived Peptide (trifluoroacetate salt)

Bone Morphogenic Protein 2-derived Peptide, KIPKASSVPTELSAISTLYL-NH2
A synthetic peptide
GC44655 PKCε Inhibitor Peptide

Protein Kinase Cɛ Inhibitor Peptide，ɛV1-2
PKCε Inhibitorpeptid (ε-V1-2), ein von PKC&7#949; abgeleitetes Peptid, ist ein selektives PKCε Inhibitor.
GC91860 Glucose-dependent Insulinotropic Peptide (22-51) (human) (trifluoroacetate salt)

GIP (22-51),Gastric Inhibitory Peptide (22-51)
Glucose-dependent insulinotropic peptide (GIP) (22-51) is a pro-atherogenic 30-amino acid peptide corresponding to residues 22-51 of the GIP precursor protein proGIP that has been found in human plasma.
GC91854 RS Repeat Peptide (trifluoroacetate salt) RS repeat peptide is a serine/arginine-rich peptide substrate for CDC-like kinase 1 (Clk1).
GC91847 KEMPFPKYPVEP Peptide (bovine, ovine) (trifluoroacetate salt) KEMPFPKYPVEP Peptide is a peptide fragment of the dairy protein β-casein.
GC91835 Heparin-binding Peptide (trifluoroacetate salt)

Fibronectin Adhesion-promoting Peptide,Fibronectin Peptide V,FN-C/H-V
Heparin-binding peptide is a synthetic peptide fragment corresponding to residues 1,892-1,899 of the C-terminal heparin-binding domain of fibronectin.
GP10091 Vasonatrin Peptide (1-27)

H2N-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH
Vasonatrin Peptide (1-27), (C124H198N36O36S3), a peptide with the sequence H2N-GLSKGCFGLKLDRIGSMSGLGCNSFRY-OH, MW= 2865.4.
GP10049 Amyloid Beta-Peptide (12-28) (human) Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)).
GP10082 Amyloid Beta-peptide (25-35) (human)
Amyloid-Beta-Peptid (25-35) (human) ist ein Fragment des Alzheimer Amyloid-Beta-Peptids, das neurotoxische Effekte hat.
GC52385 Myelin Basic Protein (85-99) Peptide Antagonist (trifluoroacetate salt)

EKPKVEAYKAAAAPA-OH, MBP (85-99) Peptide Antagonist
An MBP (85-99) antagonist
GC66061 Competence-Stimulating Peptide-2 (CSP-2) Competence-Stimulating Peptide-2 (CSP-2) ist ein Quorum-Sensing-Signalpeptid, das von Streptococcus pneumoniae produziert wird. ComD2 ist ein kompatibler Rezeptor von Competence-Stimulating Peptide-2 (CSP-2) mit einem EC50-Wert von 50,7 nM.
GC35432 Autocamtide-2-related inhibitory peptide (TFA)
GC92117 RVG Peptide (trifluoroacetate salt)

Rabies Virus Glycoprotein; Rabies Virus Glycoprotein 29; RABV-G; RVG29
RVG Peptide (trifluoroacetate salt) ist ein nikotinischer Acetylcholinrezeptor (nAChR)-Antagonist (IC50.2,5 μM für den menschlichen Rezeptor).
GC74301 FLAG peptide TFA FLAG peptide TFA ist die TFA-Salzform des FLAG-Peptids.
GC91844 [pGlu4]-Myelin Basic Protein Peptide (trifluoroacetate salt)

pGlu4-MBP Peptide
[pGlu]-Myelin basic protein peptide is a substrate for PKC.
GC52361 AMARA Peptide (trifluoroacetate salt)

AMARAASAAALARRR-OH, H-Ala-Met-Ala-Arg-Ala-Ala-Ser-Ala-Ala-Ala-Leu-Ala-Arg-Arg-Arg-OH
A peptide substrate for AMPK
GC52196 RGD Peptide

GRGDNP, HGlyArgGlyAspAsnProOH
RGD-Peptid wirkt als Inhibitor von Integrin-Liganden-Wechselwirkungen und spielt eine wichtige Rolle bei ZelladhÄsion, Migration, Wachstum und Differenzierung.
GC49883 DAPK Substrate Peptide (trifluoroacetate salt)

Death-associated Protein Kinase Substrate Peptide
A DAPK1 peptide substrate
GC48346 DYKDDDDK Peptide (trifluoroacetate salt)

DYKDDDDK Epitope, DYKDDDDK Octapeptide, DYKDDDDK Tag
GC37524 RGD peptide (GRGDNP) TFA
GC35123 3X FLAG peptide TFA
GC44806 Ras Inhibitory Peptide

Sos SH3 Domain Inhibitor
Son of sevenless homolog 1 (Sos1) is a guanine nucleotide exchange factor (GEF) that directs the exchange of Ras-GDP to Ras-GTP by binding to SH3 domains of the growth factor receptor-bound protein 2 (Grb2), leading to the activation of ERK.
GC34274 SPACE peptide SPACE-Peptid ist ein hautpenetrierendes Peptid (SPPs).
GC32787 iRGD peptide (c(CRGDKGPDC))

c(CRGDKGPDC)
Das iRGD-Peptid (c(CRGDKGPDC)) ist ein zyklisches Peptid aus 9 AminosÄuren, das die Gewebepenetration von Arzneimitteln auslÖst, indem es zuerst an av-Integrine bindet und dann im Tumor proteolytisch gespalten wird, um CRGDK/R zu produzieren, das mit Neuropilin-1 interagiert, und hat einen Tumor -zielgerichtete und tumordurchdringende Eigenschaften.
GC91470 Fyn Peptide (410-430) (human, mouse, rat, porcine, bovine) (trifluoroacetate salt)

Src (409-429) (human, rat); Src (408-428) (mouse)

Das Fyn-Peptid (410-430) ist ein Peptidfragment der Src-Familie nicht-rezeptorischer Tyrosinkinase Fyn, das Tyr420 enthält und bei Aktivierung von vollständigem Fyn einer Autophosphorylierung unterzogen wird.
GC91462 Abl Substrate Peptide (trifluoroacetate salt)
Abl-Substrat-Peptid ist ein Peptidsubstrat für die Tyrosinkinase Abl.
GC91441 RGD Peptide (trifluoroacetate salt)

GRGDNP; H-Gly-Arg-Gly-Asp-Asn-Pro-OH

Das RGD-Peptid ist eine synthetische Verbindung, die aus dem Arginin-Glycin-Aspartat-Motiv besteht und in Studien zur Zelladhäsion, Migration, Wachstum und Differenzierung umfangreich eingesetzt wurde, um Integrin-Liganden-Interaktionen zu hemmen.
GC91027 EGFRvIII Peptide (trifluoroacetate salt)
Ein EGFRvIII-Peptidfragment
GC90733 Klotho-derived Peptide 1 (56-87) (human) (trifluoroacetate salt)
Ein TGF-β-störendes Peptid
GC90635 RAD17-derived Peptide (trifluoroacetate salt)
Ein Peptidsubstrat für ATR
GC90620 N-Peptide (trifluoroacetate salt)
Ein Peptid
GC90600 Tat-NTS Peptide (trifluoroacetate salt)
Ein zellpenetrierendes Peptid
GC90561 Gastric Inhibitory Peptide (22-51) (human) (trifluoroacetate salt)
Ein pro-atherogenes Peptid.
GC90558 Myelin Basic Protein Peptide Antagonist (trifluoroacetate salt)
Ein MBP-Antagonist
GC90547 Gastric Inhibitory Peptide 1 (3-42) (human) (trifluoroacetate salt)
Ein Peptidfragment von GIP und ein GIP-Rezeptor-Antagonist
GC90546 MOG Peptide (human, bovine) (acetate)
Ein endogenes Myelinscheiden-Peptid
GC90543 EGFR Peptide (human, mouse) (myristoylated) (trifluoroacetate salt)
Ein PKC-Inhibitor
GC90542 EGFR Peptide (human, mouse) (trifluoroacetate salt)
Ein Peptid-Substrat von PKC
GC90534 Gastric Inhibitory Peptide (1-39) (porcine) (trifluoroacetate salt)
Ein Induktor der Insulinsekretion
GC90529 Myelin Basic Protein Peptide (mouse, bovine) (trifluoroacetate salt)
Ein Peptid-Substrat für PKC
GC90286 Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt)
Ein 28-aminosäurelanges Amyloid-β-Proteinfragment.
GC70187 δ-Sleep Inducing Peptide acetate

Delta-Sleep Inducing Peptide acetate

δ-Schlaf-induzierendes Peptidacetat ist ein Neuropeptid mit antioxidativen und angsthemmenden Eigenschaften.
GC17195 Bax inhibitor peptide V5

BIP-V5; BAX Inhibiting Peptide V5
A Bax inhibitor
GP10104 S6 Kinase Substrate Peptide 32

H2N-Lys-Glu-Ala-Lys-Glu-Lys-Arg-Gln-Glu-Gln-Ile-Ala-Lys-Arg-Arg-Arg-Leu-Ser-Ser-Leu-Arg-Ala-Ser-Thr-Ser-Lys-Ser-Gly-Gly-Ser-Gln-Lys-OH
Measures the activity of kinases that phosphorylate ribosomal protein S6.
GP10108 EGF-R (661-681) T669 Peptide

H2N-Lys-Arg-Glu-Leu-Val-Glu-Pro-Leu-Thr-Pro-Ser-Gly-Glu-Ala-Pro-Asn-Gln-Ala-Leu-Leu-Arg-OH
GP10011 Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell

Ac-Pro-Tyr-Asn-Ser-Ser-Pro-Arg-Pro-Glu-Gln-His-Lys-Ser-Tyr-Lys-Cys-OH
GP10098 Cdk2/Cyclin Inhibitory Peptide I

H2N-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Pro-Val-Lys-Arg-Arg-Leu-Phe-Gly-OH
GP10094 Amyloid β-peptide (10-35), amide

H2N-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-NH2
GP10147 Ribosomal protein L3 peptide (202-222) amide

H2N-Met-Ser-His-Arg-Lys-Tyr-Glu-Ala-Pro-Arg-His-Gly-His-Leu-Gly-Phe-Leu-Pro-Arg-Lys-Arg-amide
GP10042 Rhodopsin peptide

H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH
GP10127 Cadherin Peptide, avian

H2N-Leu-Arg-Ala-His-Ala-Val-Asp-Val-Asn-Gly-amide

Role in cell adhesion
GP10095 Epidermal Growth Factor Receptor Peptide (985-996)

H2N-Asp-Val-Val-Asp-Ala-Asp-Glu-Tyr-Leu-Ile-Pro-Gln-OH
GP10089 Platelet Membrane Glycoprotein IIB Peptide (296-306)

H2N-Thr-Asp-Val-Asn-Gly-Asp-Gly-Arg-His-Asp-Leu-OH

Inhibits platelet aggregation
GP10046 Amyloid Precursor C-Terminal Peptide

H2N-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH

For beta amyloid generation
GP10118 Amyloid Beta-Peptide (1-40) (human)
Amyloid β-Peptid (1-40) (human), (C194H295N53O58S1), ist ein Peptid mit der Sequenz H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid-Beta (Aβ oder Abeta) ist ein Peptid von 36–43 Aminosäuren, das aus dem Amyloid-Vorläuferprotein verarbeitet wird.
GP10022 Dynamin inhibitory peptide

Gln-Val-Pro-Ser-Arg-Pro-Asn-Arg-Ala-Pro
GA21428 Erythropoietin Mimetic Peptide Sequence 20 Peptide mimetic of erythropoietin (EPO). EMP-20 has been described to be an excellent starting point for the design of compounds with erythropoietin (EPO) mimetic activity and can serve as a minimal model for an EPO receptor antagonist.
GC26590 Hexokinase II VDAC binding domain peptide, cell-permeable

Hxk2VBD peptide;cell-permeable

Hexokinase II VDAC binding domain peptide (Hxk2VBD peptide) is a cell-permeable hexokinase II VDAC binding domain. Hexokinase II VDAC binding domain peptide inhibits mitochondrial localization of hexokinase 2 (HXK2). Hexokinase II VDAC binding domain peptide inhibits neurotrophic factor-directed axon outgrowth.
GC62069 pm26TGF-β1 peptide TFA
GC62068 pm26TGF-β1 peptide
GC26392 MANS peptide TFA
MANS peptide TFA is the TFA salt form of MANS peptide. MANS peptide TFA is an inhibitor of MARCKS, which competitively binds to MARCKS on the cell membrane, thereby inhibiting mucin secretion and tumor metastasis.
GA23574 SV40 Nuclear Transport Signal Peptide Analog NLS, cell-penetrating peptide containing 7 amino acids homologous to the SV40 T antigen, was capable of inducing the transport of several carrier proteins to the nucleus. The terminal cysteine permits the attachment of this peptide to any protein using a heterobifunctional crosslinking reagent. Coupling to plasmid DNA has also been realized by M.G.SebastyÉn and coworkers. Heterodimerization of TAT and NLS yields an even more effective transfecting peptide.
GC35334 Amyloid β Peptide (42-1)(human) Amyloid β Peptid (42-1) (Mensch) ist die inaktive Form von Amyloid β Peptid (1-42).
GC10693 c-JUN peptide JNK/c-Jun interaction inhibitor
GC26088 YAP-TEAD Inhibitor 1 (Peptide 17) YAP-TEAD Inhibitor 1 (Peptide 17) is a YAP-TEAD protein-protein interaction inhibitor which has potential usage in treatment of YAP-involved cancers with IC50 of 25 nM.
GC63447 C-Type Natriuretic Peptide (CNP) (1-22), human TFA C-Type Natriuretic Peptide (CNP) (1-22), human TFA, entfaltet seine Hauptwirkungen durch Bindung an den natriuretischen Peptidrezeptor B (NPR-B), einen membrangebundenen Guanylylcyclase-Rezeptor, der zyklisches Guanosinmonophosphat (cGMP) produziert.
GC60095 Brain Natriuretic Peptide (1-32), rat acetate

BNP (1-32), rat acetate
Brain Natriuretic Peptide (1-32), Rattenacetat (BNP (1-32), Rattenacetat) ist ein Polypeptid aus 32 AminosÄuren, das von den Ventrikeln des Herzens als Reaktion auf ÜbermÄßige Dehnung der Herzmuskelzellen (Kardiomyozyten) ausgeschieden wird .
GC36467 LL-37 scrambled peptide LL-37 Scrambled Peptide ist eine verschlÜsselte Version des antimikrobiellen Cathelicidin-Peptids LL-37.
GC36150 Glucagon-Like Peptide (GLP) I (7-36), amide, human Glucagon-Like Peptide (GLP) I (7-36), Amid, human, ist ein physiologisches Inkretinhormon, das die Insulinsekretion stimuliert.
GC36041 Fibronectin Adhesion-promoting Peptide

Heparin Binding Peptide
Fibronectin Adhesion-promoting Peptide (Trp-Glu-Pro-Pro-Arg-Ala-Arg-Ile) hat sowohl medizinisches Interesse als auch eine gut charakterisierte Struktur.

Produkte für Kategorie