- Bestell-Nr. Artikelname Informationen
- GC31523 Peptide YY (PYY) (3-36), human (Peptide YY (3-36)) Peptid YY (PYY) (3-36), human (Peptid YY (3-36)) ist ein Darmhormonpeptid, das als Y2-Rezeptoragonist wirkt, um den Appetit zu reduzieren.
-
GC44598
Peptide YY (human) (trifluoroacetate salt)
Peptide Tyrosine Tyrosine
Peptide YY (PYY) is a 36-amino acid peptide and anorectic gut hormone agonist for the neuropeptide Y receptors Y1, Y2, Y5, and Y6 with EC50 values of 0.7, 0.58, 1, and 0.8 nM, respectively, for supression of forskolin-induced cAMP accumulation.
- GC72259 Peptide A5K Peptide A5K (INF7-A5K-TAT) is an RNP delivery peptide that delivers CRISPR RNPs to T cells.
- GC63855 Peptide YY (PYY) (3-36), porcine TFA Peptid YY (PYY) (3-36), Schweine-TFA ist ein Darmhormonpeptid, das als Y2-Rezeptoragonist wirkt, um den Appetit zu reduzieren.
- GC36874 Peptide YY (PYY) (3-36), human TFA
- GC72139 Peptide5 TFA Peptide5 TFA, a connexin 43 mimetic peptide, reduces animals swelling, astrogliosis, and neuronal cell death after spinal cord injury.
- GC63141 Peptide 74 Peptid 74 ist ein synthetisches Peptid, das die ProdomÄnensequenz von Matrixmetalloproteinase (MMP) enthÄlt. Peptid 74 hemmt die aktivierte Form der 72-kDa-Typ-IV-Kollagenase in vitro.
- GC32335 Peptide T TFA Peptid T (TFA) ist ein Octapeptid aus der V2-Region von HIV-1 gp120.
- GC32309 Peptide T Peptid T ist ein Octapeptid aus der V2-Region von HIV-1 gp120.
- GC31767 Peptide 401 Peptid 401, ein starker Mastzell-Degranulationsfaktor aus Bienengift, unterdrÜckt die erhÖhte GefÄßpermeabilitÄt aufgrund der intradermalen Injektion verschiedener Spasmogene der glatten Muskulatur (Histamin und 5-HT).
- GP10131 Peptide YY(3-36), PYY, human
- GC36873 Peptide C105Y Peptid C105Y, ein synthetisches und zellgÄngiges Peptid, das auf der AminosÄuresequenz basiert, die den Resten 359-374 von α1-Antitrypsin entspricht, verstÄrkt die Genexpression von DNA-Nanopartikeln.
-
GC52502
Peptide YY (3-36) (trifluoroacetate salt)
Pancreatic Peptide YY, Peptide Tyrosine Tyrosine
A satiety hormone - GA23355 Peptide Lv (rat) Peptide Lv has been discovered via a computational bioinformatics-based screening process. The neuropeptide is expressed in retinal photoreceptor layer, hippocampus, olfactory bulb, cerebellum, cerebral cortex, lung, spleen, liver and intestine. Peptide Lv enhances L-type voltage-gated calcium channel (L-VGCC) currents in retinal photoreceptors.
- GC63347 Peptide 78 Peptid 78, ein chemotaktisches Zytokin, ein 78 AminosÄuren langes Proteinmitglied der IL-8- oder C-X-C-Chemokin-Supergenfamilie.
-
GC30452
Peptide YY (PYY), human
Peptide Tyrosine Tyrosine
Peptid YY (PYY) ist ein Darmhormon, das den Appetit reguliert und die Sekretion der BauchspeicheldrÜse hemmt. - GC30233 Peptide M Peptid M ist eine synthetische AminosÄure (18 AminosÄuren lang, die den AminosÄurepositionen 303-322 des Rinder-S-Antigens entsprechen: DTNLASSTIIKEGIDKTV), die in der Lage ist, experimentelle Autoimmun-Uveitis bei Affen und Hartley-Meerschweinchen sowie Lewis-Ratten zu induzieren .
- GA23356 Peptide WE-14 WE-14, a chromogranin A-derived peptide, was isolated from a human ileal carcinoid tumor. Its sequence WSKMDQLAKELTAE is highly conserved in many mammalian species and flanked by typical processing sites. Such factors would indicate a potential physiological role for peptide WE-14.
- GA23357 Peptide YY (13-36) (canine, mouse, porcine, rat) This C-terminal fragment was shown to suppress the noradrenaline release from sympathetic nerve endings. It thereby mimics the effects of PYY and NPY at presynaptic (Y?) receptors. The peptide was also able to compete with NPY for essentially all binding sites in rat brain.
- GA23358 Peptide YY (canine, mouse, porcine, rat)
- GC50439 Peptide5 Peptid5, ein Connexin 43-mimetisches Peptid, reduziert Schwellungen, Astrogliose und neuronalen Zelltod nach einer RÜckenmarksverletzung bei TierenIn Vitro: Peptid5 reduziert signifikant den Grad der RÜckenmarksverletzung (SCI) in einem Nagetier-Ex-vivo-Modell.
- GC30535 Transdermal Peptide (TD 1 (peptide)) Transdermal Peptide (TD 1 (peptide)), consisting of 11 amino acids, is the first transdermal enhancing peptide discovered by phage display.
- GC31172 δ-Sleep Inducing Peptide (Delta-Sleep Inducing Peptide) δ-Sleep Inducing Peptide (Delta-Sleep Inducing Peptide) ist ein Neuropeptid mit antioxidativen und anxiolytischen Eigenschaften.
-
GC31527
C-Peptide, dog (C-Peptide (dog))
C-Peptide (dog)
C-Peptid, Hund (C-Peptid (Hund)) ist ein Bestandteil von Proinsulin, das zusammen mit Insulin aus Betazellen der BauchspeicheldrÜse ins Blut freigesetzt wird. - GC35123 3X FLAG peptide TFA
- GC34397 Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) Synthetisches Sphistin-Peptid (12-38, Fitc in N-terminal fluoreszierend markiertem Peptid) ist ein verkÜrztes Fragment des synthetischen Sphistin-Peptids, das eine starke antimikrobielle AktivitÄt zeigt.
-
GP10149
3X FLAG Peptide
H-Met-Asp-Tyr-Lys-Asp-His-Asp-Gly-Asp-Tyr-Lys-Asp-His-Asp-Ile-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-OH
Synthetisches Peptid-Tag
-
GC30285
Eledoisin (Eledone peptide)
ELD 950, Moschatin
A neurokinin receptor agonist -
GC52376
BMP2-derived Peptide (trifluoroacetate salt)
Bone Morphogenic Protein 2-derived Peptide, KIPKASSVPTELSAISTLYL-NH2
A synthetic peptide -
GC44655
PKCε Inhibitor Peptide
Protein Kinase Cɛ Inhibitor Peptide,ɛV1-2
PKCε Inhibitorpeptid (ε-V1-2), ein von PKC&7#949; abgeleitetes Peptid, ist ein selektives PKCε Inhibitor. -
GC45382
Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt)
Aβ (1-28), Aβ28
-
GP10091
Vasonatrin Peptide (1-27)
H2N-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH
Vasonatrin Peptide (1-27), (C124H198N36O36S3), a peptide with the sequence H2N-GLSKGCFGLKLDRIGSMSGLGCNSFRY-OH, MW= 2865.4. - GP10049 Amyloid Beta-Peptide (12-28) (human) Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)).
-
GP10082
Amyloid Beta-peptide (25-35) (human)
Amyloid-Beta-Peptid (25-35) (human) ist ein Fragment des Alzheimer Amyloid-Beta-Peptids, das neurotoxische Effekte hat.
-
GC52385
Myelin Basic Protein (85-99) Peptide Antagonist (trifluoroacetate salt)
EKPKVEAYKAAAAPA-OH, MBP (85-99) Peptide Antagonist
An MBP (85-99) antagonist - GC66061 Competence-Stimulating Peptide-2 (CSP-2) Competence-Stimulating Peptide-2 (CSP-2) ist ein Quorum-Sensing-Signalpeptid, das von Streptococcus pneumoniae produziert wird. ComD2 ist ein kompatibler Rezeptor von Competence-Stimulating Peptide-2 (CSP-2) mit einem EC50-Wert von 50,7 nM.
-
GC52361
AMARA Peptide (trifluoroacetate salt)
AMARAASAAALARRR-OH, H-Ala-Met-Ala-Arg-Ala-Ala-Ser-Ala-Ala-Ala-Leu-Ala-Arg-Arg-Arg-OH
A peptide substrate for AMPK -
GC52196
RGD Peptide
GRGDNP, HGlyArgGlyAspAsnProOH
RGD-Peptid wirkt als Inhibitor von Integrin-Liganden-Wechselwirkungen und spielt eine wichtige Rolle bei ZelladhÄsion, Migration, Wachstum und Differenzierung. -
GC49883
DAPK Substrate Peptide (trifluoroacetate salt)
Death-associated Protein Kinase Substrate Peptide
A DAPK1 peptide substrate -
GC48346
DYKDDDDK Peptide (trifluoroacetate salt)
DYKDDDDK Epitope, DYKDDDDK Octapeptide, DYKDDDDK Tag
- GC37524 RGD peptide (GRGDNP) TFA
-
GC44806
Ras Inhibitory Peptide
Sos SH3 Domain Inhibitor
Son of sevenless homolog 1 (Sos1) is a guanine nucleotide exchange factor (GEF) that directs the exchange of Ras-GDP to Ras-GTP by binding to SH3 domains of the growth factor receptor-bound protein 2 (Grb2), leading to the activation of ERK. - GC34274 SPACE peptide SPACE-Peptid ist ein hautpenetrierendes Peptid (SPPs).
-
GC91470
Fyn Peptide (410-430) (human, mouse, rat, porcine, bovine) (trifluoroacetate salt)
Src (409-429) (human, rat); Src (408-428) (mouse)
Das Fyn-Peptid (410-430) ist ein Peptidfragment der Src-Familie nicht-rezeptorischer Tyrosinkinase Fyn, das Tyr420 enthält und bei Aktivierung von vollständigem Fyn einer Autophosphorylierung unterzogen wird.
-
GC91462
Abl Substrate Peptide (trifluoroacetate salt)
Abl-Substrat-Peptid ist ein Peptidsubstrat für die Tyrosinkinase Abl.
-
GC91441
RGD Peptide (trifluoroacetate salt)
GRGDNP; H-
Gly- Arg- Gly- Asp- Asn- Pro- OH Das RGD-Peptid ist eine synthetische Verbindung, die aus dem Arginin-Glycin-Aspartat-Motiv besteht und in Studien zur Zelladhäsion, Migration, Wachstum und Differenzierung umfangreich eingesetzt wurde, um Integrin-Liganden-Interaktionen zu hemmen.
-
GC91027
EGFRvIII Peptide (trifluoroacetate salt)
Ein EGFRvIII-Peptidfragment
-
GC90733
Klotho-derived Peptide 1 (56-87) (human) (trifluoroacetate salt)
Ein TGF-β-störendes Peptid
-
GC90635
RAD17-derived Peptide (trifluoroacetate salt)
Ein Peptidsubstrat für ATR
-
GC90620
N-Peptide (trifluoroacetate salt)
Ein Peptid
-
GC90600
Tat-NTS Peptide (trifluoroacetate salt)
Ein zellpenetrierendes Peptid
-
GC90561
Gastric Inhibitory Peptide (22-51) (human) (trifluoroacetate salt)
Ein pro-atherogenes Peptid.
-
GC90558
Myelin Basic Protein Peptide Antagonist (trifluoroacetate salt)
Ein MBP-Antagonist
-
GC90547
Gastric Inhibitory Peptide 1 (3-42) (human) (trifluoroacetate salt)
Ein Peptidfragment von GIP und ein GIP-Rezeptor-Antagonist
-
GC90546
MOG Peptide (human, bovine) (acetate)
Ein endogenes Myelinscheiden-Peptid
-
GC90543
EGFR Peptide (human, mouse) (myristoylated) (trifluoroacetate salt)
Ein PKC-Inhibitor
-
GC90542
EGFR Peptide (human, mouse) (trifluoroacetate salt)
Ein Peptid-Substrat von PKC
-
GC90534
Gastric Inhibitory Peptide (1-39) (porcine) (trifluoroacetate salt)
Ein Induktor der Insulinsekretion
-
GC90529
Myelin Basic Protein Peptide (mouse, bovine) (trifluoroacetate salt)
Ein Peptid-Substrat für PKC
-
GC90286
Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt)
Ein 28-aminosäurelanges Amyloid-β-Proteinfragment.
-
GC70187
δ-Sleep Inducing Peptide acetate
Delta-Sleep Inducing Peptide acetate
δ-Schlaf-induzierendes Peptidacetat ist ein Neuropeptid mit antioxidativen und angsthemmenden Eigenschaften.
-
GP10150
FLAG tag Peptide
H-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-OH
FLAG tag Peptide ist ein 8-Peptid (Asp-Tyr-Lys-Asp-Asp-Asp-ASP-ASP-Lys), das eine intestinale Kinase-Beschränkungsstelle enthält. -
GP10104
S6 Kinase Substrate Peptide 32
H2N-Lys-Glu-Ala-Lys-Glu-Lys-Arg-Gln-Glu-Gln-Ile-Ala-Lys-Arg-Arg-Arg-Leu-Ser-Ser-Leu-Arg-Ala-Ser-Thr-Ser-Lys-Ser-Gly-Gly-Ser-Gln-Lys-OH
Measures the activity of kinases that phosphorylate ribosomal protein S6. -
GP10108
EGF-R (661-681) T669 Peptide
H2N-Lys-Arg-Glu-Leu-Val-Glu-Pro-Leu-Thr-Pro-Ser-Gly-Glu-Ala-Pro-Asn-Gln-Ala-Leu-Leu-Arg-OH
-
GP10011
Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell
Ac-Pro-Tyr-Asn-Ser-Ser-Pro-Arg-Pro-Glu-Gln-His-Lys-Ser-Tyr-Lys-Cys-OH
-
GP10098
Cdk2/Cyclin Inhibitory Peptide I
H2N-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Pro-Val-Lys-Arg-Arg-Leu-Phe-Gly-OH
-
GP10094
Amyloid β-peptide (10-35), amide
H2N-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-NH2
-
GP10147
Ribosomal protein L3 peptide (202-222) amide
H2N-Met-Ser-His-Arg-Lys-Tyr-Glu-Ala-Pro-Arg-His-Gly-His-Leu-Gly-Phe-Leu-Pro-Arg-Lys-Arg-amide
-
GP10042
Rhodopsin peptide
H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH
-
GP10127
Cadherin Peptide, avian
H2N-Leu-Arg-Ala-His-Ala-Val-Asp-Val-Asn-Gly-amide
Role in cell adhesion
-
GP10095
Epidermal Growth Factor Receptor Peptide (985-996)
H2N-Asp-Val-Val-Asp-Ala-Asp-Glu-Tyr-Leu-Ile-Pro-Gln-OH
-
GP10089
Platelet Membrane Glycoprotein IIB Peptide (296-306)
H2N-Thr-Asp-Val-Asn-Gly-Asp-Gly-Arg-His-Asp-Leu-OH
Inhibits platelet aggregation
-
GP10046
Amyloid Precursor C-Terminal Peptide
H2N-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH
For beta amyloid generation
-
GP10118
Amyloid Beta-Peptide (1-40) (human)
Amyloid β-Peptid (1-40) (human), (C194H295N53O58S1), ist ein Peptid mit der Sequenz H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid-Beta (Aβ oder Abeta) ist ein Peptid von 36–43 Aminosäuren, das aus dem Amyloid-Vorläuferprotein verarbeitet wird.
-
GP10022
Dynamin inhibitory peptide
Gln-Val-Pro-Ser-Arg-Pro-Asn-Arg-Ala-Pro
-
GP10057
Amyloid β-Peptide (10-20) (human)
Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe
- GA21428 Erythropoietin Mimetic Peptide Sequence 20 Peptide mimetic of erythropoietin (EPO). EMP-20 has been described to be an excellent starting point for the design of compounds with erythropoietin (EPO) mimetic activity and can serve as a minimal model for an EPO receptor antagonist.
- GC62069 pm26TGF-β1 peptide TFA
- GC62068 pm26TGF-β1 peptide
- GC38520 PTD-p65-P1 Peptide TFA PTD-p65-P1-Peptid TFA ist ein potenter, selektiver Inhibitor des nuklearen Transkriptionsfaktors NF-κB und leitet sich von der p65-Untereinheit der NF-κB-AminosÄurereste 271-282 ab, die selektiv die NF-κB-Aktivierung, die durch verschiedene EntzÜndungsstimulationen induziert wird, herunter hemmt -regulieren die NF-κB-vermittelte Genexpression und regulieren die Apoptose hoch.
-
GC60095
Brain Natriuretic Peptide (1-32), rat acetate
BNP (1-32), rat acetate
Brain Natriuretic Peptide (1-32), Rattenacetat (BNP (1-32), Rattenacetat) ist ein Polypeptid aus 32 AminosÄuren, das von den Ventrikeln des Herzens als Reaktion auf ÜbermÄßige Dehnung der Herzmuskelzellen (Kardiomyozyten) ausgeschieden wird . - GC36467 LL-37 scrambled peptide LL-37 Scrambled Peptide ist eine verschlÜsselte Version des antimikrobiellen Cathelicidin-Peptids LL-37.
- GC36150 Glucagon-Like Peptide (GLP) I (7-36), amide, human Glucagon-Like Peptide (GLP) I (7-36), Amid, human, ist ein physiologisches Inkretinhormon, das die Insulinsekretion stimuliert.
-
GC36041
Fibronectin Adhesion-promoting Peptide
Heparin Binding Peptide
Fibronectin Adhesion-promoting Peptide (Trp-Glu-Pro-Pro-Arg-Ala-Arg-Ile) hat sowohl medizinisches Interesse als auch eine gut charakterisierte Struktur. - GC34233 PACAP-Related Peptide (PRP), human PACAP-Related Peptide (PRP), human, ist eine 29-AminosÄuren-Region des PACAP-VorlÄuferproteins.
-
GC34023
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine
ANF, ANP, Atrial Natriuretic Factor, α-Atriopeptin (human)
Atriales natriuretisches Peptid (ANP) (1-28), Mensch, Schwein (Atriales natriuretisches Peptid (ANP) (1-28), Mensch, Schwein) ist ein 28-AminosÄuren-Hormon, das normalerweise vom menschlichen Herzen produziert und ausgeschieden wird als Reaktion auf Herzverletzung und mechanische Dehnung. - GC33690 Crustacean Cardioactive Peptide CCAP Crustacean Cardioactive Peptide CCAP ist ein hoch konserviertes, amidiertes zyklisches Nonapeptid, das zuerst aus den Perikardorganen der Strandkrabbe Carcinus maenas isoliert wurde, wo es eine Rolle bei der Regulierung des Herzschlags spielt; Crustacean Cardioactive Peptide CCAP moduliert auch die neuronale Aktivität in anderen Arthropoden.
-
GC33600
OVA Peptide (257-264) TFA
Ser-Ile-Ile-Asn-Phe-Glu-Lys-Leu, SIINFEKL, OVA (257-264)
OVA-Peptid (257–264) TFA ist ein auf Klasse I (Kb) beschränktes Peptidepitop von OVA, ein oktameres Peptid, das von Ovalbumin stammen kann, das durch das Klasse-I-MHC-Molekül H-2Kb präsentiert wird. - GC33448 OVA Peptide 257-264 OVA-Peptid 257-264 ist ein auf Klasse I (Kb) beschränktes Peptidepitop von OVA, ein oktameres Peptid, das von Ovalbumin stammen kann, das durch das Klasse-I-MHC-Molekül H-2Kb präsentiert wird.
- GC32612 BNP-45 rat (Brain natriuretic peptide-45 rat) BNP-45 Ratte (Brain Natriuretic Peptide-45 Ratte) (BNP-45, Ratte) ist eine zirkulierende Form von Rattenhirn-natriuretischem Peptid, das aus Rattenherzen isoliert wurde, mit starker hypotensiver und natriuretischer Potenz.
- GC32589 Brain Natriuretic Peptide (BNP) (1-32), rat Brain Natriuretic Peptide (BNP) (1-32), Ratte (BNP (1-32), Ratte) ist ein 32 AminosÄuren langes Polypeptid, das von den Herzkammern als Reaktion auf eine ÜbermÄßige Dehnung der Herzmuskelzellen (Kardiomyozyten) ausgeschieden wird.
- GC32299 Bombinin-Like Peptide BLP-1 Bombinin-Like Peptide BLP-1 ist ein antimikrobielles Peptid der Bombina-Spezies.
- GC15099 Autocamtide-2-related inhibitory peptide Autocamtide-2-related inhibitory peptide ist ein hochspezifischer und potenter Inhibitor von CaMKII mit einem IC50 von 40 nM.
-
GC26392
MANS peptide TFA
MANS peptide TFA is the TFA salt form of MANS peptide. MANS peptide TFA is an inhibitor of MARCKS, which competitively binds to MARCKS on the cell membrane, thereby inhibiting mucin secretion and tumor metastasis.
- GC35334 Amyloid β Peptide (42-1)(human) Amyloid β Peptid (42-1) (Mensch) ist die inaktive Form von Amyloid β Peptid (1-42).
- GC72299 BMP2-derived peptide BMP2-derived peptide is a functional motif from positions 73 to 92 of the amino acid sequence of BMP-2. BMP2-derived peptide promotes osteogenic differentiation of bone marrow stromal cells (BMSCs) and enhances bone regeneration.
- GC72277 IRS1-derived peptide IRS1-derived peptide is a biological active peptide.
- GC72270 OVA-T4 Peptide OVA-T4 Peptide (SIITFEKL, OVA (257-264) Variant) is a biological active peptide.
- GC72268 IRBP derived peptide, R16 acetate IRBP derived peptide, R16 is a biological active peptide.
- GC72267 Dby HY Peptide (608-622), mouse Dby Peptide (608-622), mouse is a biological active peptide.