- Bestell-Nr. Artikelname Informationen
- GC31523 Peptide YY (PYY) (3-36), human (Peptide YY (3-36)) Peptid YY (PYY) (3-36), human (Peptid YY (3-36)) ist ein Darmhormonpeptid, das als Y2-Rezeptoragonist wirkt, um den Appetit zu reduzieren.
-
GC44598
Peptide YY (human) (trifluoroacetate salt)
Peptide YY (PYY) is a 36-amino acid peptide and anorectic gut hormone agonist for the neuropeptide Y receptors Y1, Y2, Y5, and Y6 with EC50 values of 0.7, 0.58, 1, and 0.8 nM, respectively, for supression of forskolin-induced cAMP accumulation.
- GC63855 Peptide YY (PYY) (3-36), porcine TFA Peptid YY (PYY) (3-36), Schweine-TFA ist ein Darmhormonpeptid, das als Y2-Rezeptoragonist wirkt, um den Appetit zu reduzieren.
- GC36874 Peptide YY (PYY) (3-36), human TFA
- GC63141 Peptide 74 Peptid 74 ist ein synthetisches Peptid, das die ProdomÄnensequenz von Matrixmetalloproteinase (MMP) enthÄlt. Peptid 74 hemmt die aktivierte Form der 72-kDa-Typ-IV-Kollagenase in vitro.
- GC32335 Peptide T TFA Peptid T (TFA) ist ein Octapeptid aus der V2-Region von HIV-1 gp120.
- GC32309 Peptide T Peptid T ist ein Octapeptid aus der V2-Region von HIV-1 gp120.
- GC31767 Peptide 401 Peptid 401, ein starker Mastzell-Degranulationsfaktor aus Bienengift, unterdrÜckt die erhÖhte GefÄßpermeabilitÄt aufgrund der intradermalen Injektion verschiedener Spasmogene der glatten Muskulatur (Histamin und 5-HT).
- GP10131 Peptide YY(3-36), PYY, human
- GC36873 Peptide C105Y Peptid C105Y, ein synthetisches und zellgÄngiges Peptid, das auf der AminosÄuresequenz basiert, die den Resten 359-374 von α1-Antitrypsin entspricht, verstÄrkt die Genexpression von DNA-Nanopartikeln.
- GC52502 Peptide YY (3-36) (trifluoroacetate salt) A satiety hormone
- GA23355 Peptide Lv (rat) Peptide Lv has been discovered via a computational bioinformatics-based screening process. The neuropeptide is expressed in retinal photoreceptor layer, hippocampus, olfactory bulb, cerebellum, cerebral cortex, lung, spleen, liver and intestine. Peptide Lv enhances L-type voltage-gated calcium channel (L-VGCC) currents in retinal photoreceptors.
- GC63347 Peptide 78 Peptid 78, ein chemotaktisches Zytokin, ein 78 AminosÄuren langes Proteinmitglied der IL-8- oder C-X-C-Chemokin-Supergenfamilie.
- GC30452 Peptide YY (PYY), human Peptid YY (PYY) ist ein Darmhormon, das den Appetit reguliert und die Sekretion der BauchspeicheldrÜse hemmt.
- GC30233 Peptide M Peptid M ist eine synthetische AminosÄure (18 AminosÄuren lang, die den AminosÄurepositionen 303-322 des Rinder-S-Antigens entsprechen: DTNLASSTIIKEGIDKTV), die in der Lage ist, experimentelle Autoimmun-Uveitis bei Affen und Hartley-Meerschweinchen sowie Lewis-Ratten zu induzieren .
- GA23356 Peptide WE-14 WE-14, a chromogranin A-derived peptide, was isolated from a human ileal carcinoid tumor. Its sequence WSKMDQLAKELTAE is highly conserved in many mammalian species and flanked by typical processing sites. Such factors would indicate a potential physiological role for peptide WE-14.
- GA23357 Peptide YY (13-36) (canine, mouse, porcine, rat) This C-terminal fragment was shown to suppress the noradrenaline release from sympathetic nerve endings. It thereby mimics the effects of PYY and NPY at presynaptic (Y?) receptors. The peptide was also able to compete with NPY for essentially all binding sites in rat brain.
- GA23358 Peptide YY (canine, mouse, porcine, rat)
- GC50439 Peptide5 Peptid5, ein Connexin 43-mimetisches Peptid, reduziert Schwellungen, Astrogliose und neuronalen Zelltod nach einer RÜckenmarksverletzung bei TierenIn Vitro: Peptid5 reduziert signifikant den Grad der RÜckenmarksverletzung (SCI) in einem Nagetier-Ex-vivo-Modell.
- GC30535 Transdermal Peptide (TD 1 (peptide)) Transdermal Peptide (TD 1 (peptide)), consisting of 11 amino acids, is the first transdermal enhancing peptide discovered by phage display.
- GC31172 δ-Sleep Inducing Peptide (Delta-Sleep Inducing Peptide) δ-Sleep Inducing Peptide (Delta-Sleep Inducing Peptide) ist ein Neuropeptid mit antioxidativen und anxiolytischen Eigenschaften.
- GC31527 C-Peptide, dog (C-Peptide (dog)) C-Peptid, Hund (C-Peptid (Hund)) ist ein Bestandteil von Proinsulin, das zusammen mit Insulin aus Betazellen der BauchspeicheldrÜse ins Blut freigesetzt wird.
- GC35123 3X FLAG peptide TFA
- GC34397 Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) Synthetisches Sphistin-Peptid (12-38, Fitc in N-terminal fluoreszierend markiertem Peptid) ist ein verkÜrztes Fragment des synthetischen Sphistin-Peptids, das eine starke antimikrobielle AktivitÄt zeigt.
-
GP10149
3X FLAG Peptide
Synthetisches Peptid-Tag
- GC30285 Eledoisin (Eledone peptide) A neurokinin receptor agonist
-
GP10118
Amyloid Beta-Peptide (1-40) (human)
Amyloid β-Peptid (1-40) (human), (C194H295N53O58S1), ist ein Peptid mit der Sequenz H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid-Beta (Aβ oder Abeta) ist ein Peptid von 36–43 Aminosäuren, das aus dem Amyloid-Vorläuferprotein verarbeitet wird.
- GC45382 Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt)
- GC52376 BMP2-derived Peptide (trifluoroacetate salt) A synthetic peptide
- GC44655 PKCε Inhibitor Peptide PKCε Inhibitorpeptid (ε-V1-2), ein von PKC&7#949; abgeleitetes Peptid, ist ein selektives PKCε Inhibitor.
- GP10091 Vasonatrin Peptide (1-27) Vasonatrin Peptide (1-27), (C124H198N36O36S3), a peptide with the sequence H2N-GLSKGCFGLKLDRIGSMSGLGCNSFRY-OH, MW= 2865.4.
-
GP10049
Amyloid Beta-Peptide (12-28) (human)
Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)).
-
GP10082
Amyloid Beta-peptide (25-35) (human)
Amyloid-Beta-Peptid (25-35) (human) ist ein Fragment des Alzheimer Amyloid-Beta-Peptids, das neurotoxische Effekte hat.
- GC52385 Myelin Basic Protein (85-99) Peptide Antagonist (trifluoroacetate salt) An MBP (85-99) antagonist
- GC66061 Competence-Stimulating Peptide-2 (CSP-2) Competence-Stimulating Peptide-2 (CSP-2) ist ein Quorum-Sensing-Signalpeptid, das von Streptococcus pneumoniae produziert wird. ComD2 ist ein kompatibler Rezeptor von Competence-Stimulating Peptide-2 (CSP-2) mit einem EC50-Wert von 50,7 nM.
- GC52361 AMARA Peptide (trifluoroacetate salt) A peptide substrate for AMPK
- GC52196 RGD Peptide RGD-Peptid wirkt als Inhibitor von Integrin-Liganden-Wechselwirkungen und spielt eine wichtige Rolle bei ZelladhÄsion, Migration, Wachstum und Differenzierung.
- GC49883 DAPK Substrate Peptide (trifluoroacetate salt) A DAPK1 peptide substrate
- GC48346 DYKDDDDK Peptide (trifluoroacetate salt)
- GC37524 RGD peptide (GRGDNP) TFA
- GC44806 Ras Inhibitory Peptide Son of sevenless homolog 1 (Sos1) is a guanine nucleotide exchange factor (GEF) that directs the exchange of Ras-GDP to Ras-GTP by binding to SH3 domains of the growth factor receptor-bound protein 2 (Grb2), leading to the activation of ERK.
- GC34274 SPACE peptide SPACE-Peptid ist ein hautpenetrierendes Peptid (SPPs).
-
GC70187
δ-Sleep Inducing Peptide acetate
δ-Schlaf-induzierendes Peptidacetat ist ein Neuropeptid mit antioxidativen und angsthemmenden Eigenschaften.
-
GP10150
FLAG tag Peptide
Das FLAG-Tag-Peptid ist ein 8-Peptid (Asp-Tyr-Lys-Asp-Asp-Asp-ASP-ASP-Lys), das eine intestinale Kinase-Restriktionstelle enthält.
- GP10104 S6 Kinase Substrate Peptide 32 Measures the activity of kinases that phosphorylate ribosomal protein S6.
- GP10108 EGF-R (661-681) T669 Peptide
- GP10011 Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell
- GP10098 Cdk2/Cyclin Inhibitory Peptide I
- GP10094 Amyloid β-peptide (10-35), amide
- GP10147 Ribosomal protein L3 peptide (202-222) amide
- GP10042 Rhodopsin peptide
-
GP10127
Cadherin Peptide, avian
Role in cell adhesion
- GP10095 Epidermal Growth Factor Receptor Peptide (985-996)
-
GP10043
GnRH Associated Peptide (GAP) (1-13), human
Inhibitor of prolactin secretion
-
GP10089
Platelet Membrane Glycoprotein IIB Peptide (296-306)
Inhibits platelet aggregation
-
GP10046
Amyloid Precursor C-Terminal Peptide
For beta amyloid generation
- GP10022 Dynamin inhibitory peptide
- GP10057 Amyloid β-Peptide (10-20) (human)
- GA21428 Erythropoietin Mimetic Peptide Sequence 20 Peptide mimetic of erythropoietin (EPO). EMP-20 has been described to be an excellent starting point for the design of compounds with erythropoietin (EPO) mimetic activity and can serve as a minimal model for an EPO receptor antagonist.
-
GP10152
Influenza Hemagglutinin (HA) Peptide
Ein Peptid
- GC62069 pm26TGF-β1 peptide TFA
- GC62068 pm26TGF-β1 peptide
- GC38520 PTD-p65-P1 Peptide TFA PTD-p65-P1-Peptid TFA ist ein potenter, selektiver Inhibitor des nuklearen Transkriptionsfaktors NF-κB und leitet sich von der p65-Untereinheit der NF-κB-AminosÄurereste 271-282 ab, die selektiv die NF-κB-Aktivierung, die durch verschiedene EntzÜndungsstimulationen induziert wird, herunter hemmt -regulieren die NF-κB-vermittelte Genexpression und regulieren die Apoptose hoch.
- GC60095 Brain Natriuretic Peptide (1-32), rat acetate Brain Natriuretic Peptide (1-32), Rattenacetat (BNP (1-32), Rattenacetat) ist ein Polypeptid aus 32 AminosÄuren, das von den Ventrikeln des Herzens als Reaktion auf ÜbermÄßige Dehnung der Herzmuskelzellen (Kardiomyozyten) ausgeschieden wird .
- GC36467 LL-37 scrambled peptide LL-37 Scrambled Peptide ist eine verschlÜsselte Version des antimikrobiellen Cathelicidin-Peptids LL-37.
- GC36150 Glucagon-Like Peptide (GLP) I (7-36), amide, human Glucagon-Like Peptide (GLP) I (7-36), Amid, human, ist ein physiologisches Inkretinhormon, das die Insulinsekretion stimuliert.
-
GC36041
Fibronectin Adhesion-promoting Peptide
Das Adhäsionsfördernde Peptid von Fibronectin ist ein potenter Induktor von Stressfasern und Fokaladhäsionen in Fibroblasten, die an der Bildung von Thrombosen beteiligt sind, die mit Krankheiten wie der atherosklerotischen Herz-Kreislauf-Erkrankung zusammenhängen.
- GC34233 PACAP-Related Peptide (PRP), human PACAP-Related Peptide (PRP), human, ist eine 29-AminosÄuren-Region des PACAP-VorlÄuferproteins.
- GC34023 Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Atriales natriuretisches Peptid (ANP) (1-28), Mensch, Schwein (Atriales natriuretisches Peptid (ANP) (1-28), Mensch, Schwein) ist ein 28-AminosÄuren-Hormon, das normalerweise vom menschlichen Herzen produziert und ausgeschieden wird als Reaktion auf Herzverletzung und mechanische Dehnung.
- GC33690 Crustacean Cardioactive Peptide CCAP Crustacean Cardioactive Peptide CCAP ist ein hoch konserviertes, amidiertes zyklisches Nonapeptid, das zuerst aus den Perikardorganen der Strandkrabbe Carcinus maenas isoliert wurde, wo es eine Rolle bei der Regulierung des Herzschlags spielt; Crustacean Cardioactive Peptide CCAP moduliert auch die neuronale Aktivität in anderen Arthropoden.
- GC33600 OVA Peptide (257-264) TFA OVA-Peptid (257–264) TFA ist ein auf Klasse I (Kb) beschränktes Peptidepitop von OVA, ein oktameres Peptid, das von Ovalbumin stammen kann, das durch das Klasse-I-MHC-Molekül H-2Kb präsentiert wird.
- GC33448 OVA Peptide 257-264 OVA-Peptid 257-264 ist ein auf Klasse I (Kb) beschränktes Peptidepitop von OVA, ein oktameres Peptid, das von Ovalbumin stammen kann, das durch das Klasse-I-MHC-Molekül H-2Kb präsentiert wird.
- GC32612 BNP-45 rat (Brain natriuretic peptide-45 rat) BNP-45 Ratte (Brain Natriuretic Peptide-45 Ratte) (BNP-45, Ratte) ist eine zirkulierende Form von Rattenhirn-natriuretischem Peptid, das aus Rattenherzen isoliert wurde, mit starker hypotensiver und natriuretischer Potenz.
- GC32589 Brain Natriuretic Peptide (BNP) (1-32), rat Brain Natriuretic Peptide (BNP) (1-32), Ratte (BNP (1-32), Ratte) ist ein 32 AminosÄuren langes Polypeptid, das von den Herzkammern als Reaktion auf eine ÜbermÄßige Dehnung der Herzmuskelzellen (Kardiomyozyten) ausgeschieden wird.
- GC32299 Bombinin-Like Peptide BLP-1 Bombinin-Like Peptide BLP-1 ist ein antimikrobielles Peptid der Bombina-Spezies.
- GC15099 Autocamtide-2-related inhibitory peptide Autocamtide-2-related inhibitory peptide ist ein hochspezifischer und potenter Inhibitor von CaMKII mit einem IC50 von 40 nM.
-
GC68908
C-Type Natriuretic Peptide (1-53), human TFA
C-Typ Natriuretisches Peptid (1-53), humanes TFA ist ein Fragment des C-Typs Natriuretisches Peptids. C-Type Natriuretic Peptide TFA gehört zur Familie der natriuretischen Peptide und ist an der Aufrechterhaltung des Elektrolyt-Flüssigkeitsgleichgewichts und des Gefäßtonus beteiligt.
- GC64476 Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat acetate Myelin-Oligodendrozyten-Glycoprotein-Peptid (35-55), Maus, Ratte (MOG (35-55))-Acetat ist ein untergeordneter Bestandteil des ZNS-Myelins.
- GC64248 c-Myc Peptide TFA c-Myc-Peptid (TFA) ist ein synthetisches Peptid, das den C-terminalen AminosÄuren (410-419) des menschlichen c-myc-Proteins entspricht und an der Regulierung der wachstumsbezogenen Gentranskription beteiligt ist.
- GC63889 Proteasome-activating peptide 1 TFA Proteasom-aktivierendes Peptid 1 TFA ist ein Peptid und ein potenter Proteasom-Aktivator.
- GC63766 G-Protein antagonist peptide TFA G-Protein-Antagonist-Peptid TFA ist ein verkÜrztes, mit der Substanz P verwandtes Peptid, das mit dem Rezeptor um die G-Protein-Bindung konkurriert.
- GC63708 Uty HY Peptide (246-254) (TFA) Uty HY-Peptid (246-254) TFA, abgeleitet vom allgegenwÄrtig transkribierten Tetratricopeptid-Wiederholungsgen auf dem Y-Chromosom (UTY)-Protein als H-Y-Epitop, H-YDb, ist ein mÄnnliches spezifisches Transplantationsantigen H-Y.
- GC63447 C-Type Natriuretic Peptide (CNP) (1-22), human TFA C-Typ Natriuretisches Peptid (CNP) (1-22), menschliches TFA, entfaltet seine Hauptbiowirkungen durch Bindung an den natriuretischen Peptidrezeptor B (NPR-B), einen membrangebundenen Guanylylcyclase-Rezeptor, der zyklisches Guanosinmonophosphat (cGMP) produziert.
- GC61375 VSV-G tag Peptide Das VSV-G-Peptid ist ein Peptid aus 11 AminosÄuren, das aus dem viralen Glykoprotein der vesikulÄren Stomatitis stammt.
- GC36893 Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa Phe-Met-Arg-Phe-Ähnliches Peptid, Snail Helix aspersa ist ein FMRF-Ähnliches Peptid aus viszeralen und somatischen Muskeln der Schnecke Helix aspersa.
- GC36670 Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat (TFA)
- GC35549 Brain Natriuretic Peptide (BNP) (1-32), rat TFA
- GC35426 Atrial Natriuretic Peptide (ANP) (1-28), rat TFA Atriales natriuretisches Peptid (ANP) (1-28), Ratte (TFA) ist eine in Ratten zirkulierende Hauptform von ANP und hemmt wirksam die durch Angiotensin II (Ang II) stimulierte Endothelin-1-Sekretion in einer konzentrationsabhÄngigen Weise.
- GC44654 PKCα (C2-4) Inhibitor Peptide The C2 domain of conventional PKC isoforms mediates calcium-dependent translocation.
- GC42871 Atrial Natriuretic Peptide (1-28) (rat) (trifluoroacetate salt) Atrial natriuretic peptide (ANP) is an endogenous peptide generated by proteolysis of prepro-ANP that is secreted by cardiomyocytes in the heart.
- GC34400 c-Myc Peptide Trifluoroacetate
- GC34396 Calcitonin Gene Related Peptide (CGRP) (83-119), rat
- GC34395 Calcitonin Gene Related Peptide (CGRP) (83-119), rat TFA
- GC34266 OVA Peptide 323-339 Das OVA-Peptid (323-339) stellt ein T- und B-Zell-Epitop von Ovalbumin (Ova) dar, das bei der Erzeugung und Entwicklung von unmittelbaren Überempfindlichkeitsreaktionen in BALB/c-MÄusen wichtig ist.
- GC34025 Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate Atriales natriuretisches Peptid (ANP) (1-28), human, porcines Acetat (Atriales natriuretisches Peptid (ANP) (1-28), humanes, porcines Acetat) ist ein 28-AminosÄuren-Hormon, das normalerweise von produziert und ausgeschieden wird menschliches Herz als Reaktion auf Herzverletzung und mechanische Dehnung.
- GC33599 PAR-4 Agonist Peptide, amide TFA (PAR-4-AP (TFA)) PAR-4-Agonist-Peptid, Amid TFA (PAR-4-AP (TFA)) (PAR-4-AP TFA; AY-NH2 TFA) ist ein Proteinase-aktivierter Rezeptor-4 (PAR-4)-Agonist, der keine Wirkung hat auf entweder PAR-1 oder PAR-2 und deren Wirkungen durch einen PAR-4-Antagonisten blockiert werden.
- GC33585 β-catenin peptide β-catenin-Peptid ist ein 8-aa-Peptid und kann die positive Selektion von Thymozyten fÖrdern.
- GP10151 c-Myc tag Peptide
-
GP10112
TRH Precursor Peptide
Thyrotropin Releasing Hormone Precursor Peptide
- GC52476 Bax Inhibitor Peptide V5 (trifluoroacetate salt) A Bax inhibitor