Growth Hormone (1-43), human (Synonyms: H2N-Phe-Pro-Thr-Ile-Pro-Leu-Ser-Arg-Leu-Phe-Asp-Asn-Ala-Met-Leu-Arg-Ala-His-Arg-Leu-His-Gln-Leu-Ala-Phe-Asp-Thr-Tyr-Gln-Glu-Phe-Glu-Glu-Ala-Tyr-Ile-Pro-Lys-Glu-Gln-Lys-Tyr-Ser-OH ) |
| Catalog No.GP10024 |
Human Growth Hormone (1-43) peptide
Products are for research use only. Not for human use. We do not sell to patients.
Sample solution is provided at 25 µL, 10mM.
Growth Hormone (1-43), human (C240H358N62O67S1), a peptide with the sequence H2N-FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKY
S-OH, MW= 5216.2. Growth hormone (GH or HGH), also known as somatotropin or somatropin, is a peptide hormone that stimulates growth, cell reproduction and regeneration in humans and other animals. It is a type of mitogen which is specific only to certain kinds of cells. Growth hormone is a 191-amino acid, single-chain polypeptide that is synthesized, stored, and secreted by somatotropic cells within the lateral wings of the anterior pituitary gland.Growth hormone is used as a prescription drug in medicine to treat children's growth disorders and adult growth hormone deficiency(1). Effects of growth hormone on the tissues of the body can generally be described as anabolic (building up). Like most other protein hormones, GH acts by interacting with a specific receptor on the surface of cells.Because polypeptide hormones are not fat-soluble, they cannot penetrate cell membranes. Thus, GH exerts some of its effects by binding to receptors on target cells, where it activates the MAPK/ERK pathway(2).Through this mechanism GH directly stimulates division and multiplication of chondrocytes of cartilage.GH also stimulates, through the JAK-STAT signaling pathway,the production of insulin-like growth factor 1 (IGF-1, formerly known as somatomedin C), a hormone homologous to proinsulin(3).The liver is a major target organ of GH for this process and is the principal site of IGF-1 production. IGF-1 has growth-stimulating effects on a wide variety of tissues. Additional IGF-1 is generated within target tissues, making it what appears to be both an endocrine and an autocrine/paracrine hormone. IGF-1 also has stimulatory effects on osteoblast and chondrocyte activity to promote bone growth.

Figure1 the structures of Growth Hormone

Figure 2 Mechanisms of Growth Hormone regulaltion
Ref:
1. Powers M (2005). "Performance-Enhancing Drugs". In Leaver-Dunn D, Houglum J, Harrelson GL. Principles of Pharmacology for Athletic Trainers. Slack Incorporated. pp. 331–332.
2. Binder G, Wittekindt N, Ranke MB (February 2007). "Noonan Syndrome: Genetics and Responsiveness to Growth Hormone Therapy". Horm Res 67 (Supplement 1): 45–49.
3. Actions of Anterior Pituitary Hormones: Physiologic Actions of GH". Medical College of Georgia. 2007.
| Cell experiment: [1] | |
|
Cell lines |
FDC-P1 cells |
|
Preparation method |
The solubility of this peptide in sterile water is >10 mM. Stock solution should be splited and stored at -80°C for several months. |
|
Reaction Conditions |
IC50: 2 μM |
|
Applications |
The in vitro bioactivity of the hGH fragment was tested by its activity against GH-responsive FDC-P1 cell lines expressing full-length human (h), mouse (m), or rabbit (r) GH receptors (GHR). Recombinant hGH 1-43 stimulated proliferation of FDC-P1-hGHR cells with half-maximal effect at approximately 2000 nM. It had minimal effect on cells expressing mGHR or rGHR. |
| Animal experiment: | |
|
Animal models |
|
|
Dosage form |
|
|
Applications |
|
|
Other notes |
Please test the solubility of all compounds indoor, and the actual solubility may slightly differ with the theoretical value. This is caused by an experimental system error and it is normal. |
|
References: [1] Rowlinson S W, Waters M J, Lewis U J, et al. Human growth hormone fragments 1-43 and 44-191: in vitro somatogenic activity and receptor binding characteristics in human and nonprimate systems. Endocrinology, 1996, 137(1): 90-95. | |
| Cas No. | SDF | ||
| Synonyms | H2N-Phe-Pro-Thr-Ile-Pro-Leu-Ser-Arg-Leu-Phe-Asp-Asn-Ala-Met-Leu-Arg-Ala-His-Arg-Leu-His-Gln-Leu-Ala-Phe-Asp-Thr-Tyr-Gln-Glu-Phe-Glu-Glu-Ala-Tyr-Ile-Pro-Lys-Glu-Gln-Lys-Tyr-Ser-OH | ||
| Formula | C240H358N62O67S1 | M.Wt | 5216.2 |
| Solubility | Storage | Store at -20°C | |
| General tips | Please select the appropriate solvent to prepare the stock solution according to the
solubility of the product in different solvents; once the solution is prepared, please store it in
separate packages to avoid product failure caused by repeated freezing and thawing.Storage method
and period of the stock solution: When stored at -80°C, please use it within 6 months; when stored
at -20°C, please use it within 1 month. To increase solubility, heat the tube to 37°C and then oscillate in an ultrasonic bath for some time. |
||
| Shipping Condition | Evaluation sample solution: shipped with blue ice. All other sizes available: with RT, or with Blue Ice upon request. | ||
| Prepare stock solution | |||
|
1 mg | 5 mg | 10 mg |
| 1 mM | 191.7 μL | 958.6 μL | 1.9171 mL |
| 5 mM | 38.3 μL | 191.7 μL | 383.4 μL |
| 10 mM | 19.2 μL | 95.9 μL | 191.7 μL |
Step 1: Enter information below (Recommended: An additional animal making an allowance for loss during the experiment)
Step 2: Enter the in vivo formulation (This is only the calculator, not formulation. Please contact us first if there is no in vivo formulation at the solubility Section.)
Calculation results:
Working concentration: mg/ml;
Method for preparing DMSO master liquid: mg drug pre-dissolved in μL DMSO ( Master liquid concentration mg/mL, Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug. )
Method for preparing in vivo formulation: Take μL DMSO master liquid, next addμL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O, mix and clarify.
Method for preparing in vivo formulation: Take μL DMSO master liquid, next add μL Corn oil, mix and clarify.
Note: 1. Please make sure the liquid is clear before adding the next solvent.
2. Be sure to add the solvent(s) in order. You must ensure that the solution obtained, in the previous addition, is a clear solution before proceeding to add the next solvent. Physical methods such as vortex, ultrasound or hot water bath can be used to aid dissolving.
3. All of the above co-solvents are available for purchase on the GlpBio website.
Quality Control & SDS
- View current batch:
- Purity: >98.00%
- COA (Certificate Of Analysis)
- SDS (Safety Data Sheet)
- Datasheet
Average Rating: 5 (Based on Reviews and 30 reference(s) in Google Scholar.)
GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *















