Home>>Signaling Pathways>> Immunology/Inflammation>> Interleukin Related>>Anakinra

Anakinra (Synonyms: AMG-719)

Catalog No.GC39339 Copy One-Click Copy Product Info

Anakinra (AMG-719, Raleukin)is a recombinant, non glycosylated human interleukin-1 receptor antagonist (IL-1Ra).

Products are for research use only. Not for human use. We do not sell to patients.

Anakinra Chemical Structure

Cas No.: 143090-92-0

Size Price Stock Qty
1mg
$143.00
In stock
5mg
$315.00
In stock
10mg
$495.00
In stock

Tel:(909) 407-4943 Email: sales@glpbio.com


Customer Reviews

Based on customer reviews.

Sample solution is provided at 25 µL, 10mM.



Product has been cited by 1 publications

Description of Anakinra

Anakinra (AMG-719, Raleukin) is a recombinant, non glycosylated human interleukin-1 receptor antagonist (IL-1Ra). It is produced using DNA recombination technology in the Escherichia coli expression system andamino acid sequence is MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE. Anakinra represents the inaugural biological therapy designed to neutralize the inflammatory actions of IL-1[1][2]. Anakinra has been proven effective for the treatment of various inflammatory and autoimmune diseases, including Still's disease[3].

Anakinra was administered at a dose of 100 mg/kg via intraperitoneal injection, and the same route was used to administer Etanercept at a dose of 5 mg/kg daily for seven consecutive days, which significantly facilitated the successful implantation of marginal quality human islet cells in mice with impaired immune systems [2]. Anakinra enhances tumor growth inhibition in mice receiving peptide vaccination and treated with beta-(1-3),(1-6)-D-glucan by blocking the IL-1 receptor and reducing IL-1-induced IL-6 production[4].

References:
[1] Cvetkovic RS, et al. Anakinra. BioDrugs. 2002;16(4):303-11; discussion 313-4.
[2] McCall M, et al. Anakinra potentiates the protective effects of etanercept in transplantation of marginal mass human islets in immunodeficient mice. Am J Transplant. 2012 Feb;12(2):322-9.
[3] Vastert Sebastiaan J, et al. Anakinra in children and adults with Still's disease. Rheumatology (Oxford) 2019 Nov 1;58(Suppl 6):vi9-vi22. PMID:31769856. DOI:10.1093/rheumatology/kez350.
[4] Harnack U, et al. IL-1 receptor antagonist anakinra enhances tumour growth inhibition in mice receiving peptide vaccination and beta-(1-3),(1-6)-D-glucan. Anticancer Res. 2010 Oct;30(10):3959-65.

Protocol of Anakinra

Animal experiment [1]:

Animal models

Immunodeficient mice

Preparation Method

The simultaneous administration of Etanercept (at a dosage of 5 mg/kg, via intraperitoneal injection) coupled with daily Anakinra (at a dosage of 100 mg/kg, also via intraperitoneal injection for a period of 7 days).

Dosage form

100 mg/kg, daily for 7 days, intraperitoneal injection

Applications

The simultaneous administration of Etanercept coupled with daily Anakinra significantly enhanced the engraftment of marginal mass human islets in immunodeficient mice.

References:
[1] McCall M, et al. Anakinra potentiates the protective effects of etanercept in transplantation of marginal mass human islets in immunodeficient mice. Am J Transplant. 2012 Feb;12(2):322-9.

Chemical Properties of Anakinra

Cas No. 143090-92-0 SDF
Synonyms AMG-719
Canonical SMILES [Anakinra]
Formula C759H1186N208O232S10 M.Wt 17257.6
Solubility Soluble in DMSO Storage Store at 4°C, do not freeze
General tips Please select the appropriate solvent to prepare the stock solution according to the solubility of the product in different solvents; once the solution is prepared, please store it in separate packages to avoid product failure caused by repeated freezing and thawing.Storage method and period of the stock solution: When stored at -80°C, please use it within 6 months; when stored at -20°C, please use it within 1 month.
To increase solubility, heat the tube to 37°C and then oscillate in an ultrasonic bath for some time.
Shipping Condition Evaluation sample solution: shipped with blue ice. All other sizes available: with RT, or with Blue Ice upon request.

Complete Stock Solution Preparation Table of Anakinra

Prepare stock solution
1 mg 5 mg 10 mg
1 mM 57.9 μL 289.7 μL 579.5 μL
5 mM 11.6 μL 57.9 μL 115.9 μL
10 mM 5.8 μL 29 μL 57.9 μL
  • Molarity Calculator

  • Dilution Calculator

  • Molecular Weight Calculator

Mass
=
Concentration
x
Volume
x
MW*
 
 
 
**When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and MSDS / CoA (available online).

Calculate

In vivo Formulation Calculator (Clear solution) of Anakinra

Step 1: Enter information below (Recommended: An additional animal making an allowance for loss during the experiment)

mg/kg g μL

Step 2: Enter the in vivo formulation (This is only the calculator, not formulation. Please contact us first if there is no in vivo formulation at the solubility Section.)

% DMSO % % Tween 80 % saline
%DMSO %

Calculation results:

Working concentration: mg/ml;

Method for preparing DMSO master liquid: mg drug pre-dissolved in μL DMSO ( Master liquid concentration mg/mL, Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug. )

Method for preparing in vivo formulation: Take μL DMSO master liquid, next addμL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL saline, mix and clarify.

Method for preparing in vivo formulation: Take μL DMSO master liquid, next add μL Corn oil, mix and clarify.

Note: 1. Please make sure the liquid is clear before adding the next solvent.
2. Be sure to add the solvent(s) in order. You must ensure that the solution obtained, in the previous addition, is a clear solution before proceeding to add the next solvent. Physical methods such as vortex, ultrasound or hot water bath can be used to aid dissolving.
3. All of the above co-solvents are available for purchase on the GlpBio website.

Product Documents

Quality Control & SDS

View current batch:

Reviews

Review for Anakinra

Average Rating: 5 ★★★★★ (Based on Reviews and 29 reference(s) in Google Scholar.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%