Startseite >> Signaling Pathways >> Neuroscience >> Amyloid β

Amyloid β

Amyloid β denotes peptides of 36–43 amino acids result from the APP (amyloid precursor protein) and are involved in Alzheimer's disease as the main component of the amyloid plaques.

Produkte für  Amyloid β

  1. Bestell-Nr. Artikelname Informationen
  2. GC63273 β-Amyloid (1-14),mouse,rat β-Amyloid (1-14),mouse,rat  Chemical Structure
  3. GC66089 β-Amyloid (1-40) (TFA) β-Amyloid (1-40) TFA ist ein primÄres Protein in Plaques, die im Gehirn von Patienten mit Alzheimer-Krankheit gefunden werden. β-Amyloid (1-40) (TFA)  Chemical Structure
  4. GC70182 β-Amyloid (1-40), FAM-labeled TFA

    β-Amyloid (1-40), FAM-markiert TFA ist ein mit FAM markiertes fluoreszierendes Peptid von β-Amyloid (1-40) (Λex= 492 nm und Λem= 518 nm).

    β-Amyloid (1-40), FAM-labeled TFA  Chemical Structure
  5. GC63274 β-Amyloid (1-42), (rat/mouse) (TFA) β-Amyloid (1-42), (rat/mouse) (TFA)  Chemical Structure
  6. GC37984 β-Amyloid (1-42), rat β-Amyloid (1-42), Ratte, ist ein Peptid mit 42 AminosÄuren, zeigt eine zytotoxische Wirkung auf akute Hippocampus-Schnitte und wird in der Erforschung der Alzheimer-Krankheit verwendet. β-Amyloid (1-42), rat  Chemical Structure
  7. GC66416 β-Amyloid (22-35) (TFA) β-Amyloid 22-35 (Amyloid β-Protein 22-35) TFA, das Fragment der Reste 22-35 von β-Amyloid-Protein, hat eine zytotoxische Wirkung auf kultivierte Neuronen aus dem Hippocampus der Ratte in serumfreiem Medium. β-Amyloid 22-35 TFA bildet Aggregate und typische Amyloidfibrillen, die denen des &7#946;-Amyloidproteins in neutraler PufferlÖsung Ähneln). β-Amyloid (22-35) (TFA)  Chemical Structure
  8. GC66346 β-Amyloid (42-1), human TFA β-Amyloid (42-1), menschliches TFA ist die inaktive Form von Amyloid β Peptid (1-42). β-Amyloid (42-1), menschliches TFA, ist ein 42 AminosÄuren langes Peptid, das eine SchlÜsselrolle in der Pathogenese der Alzheimer-Krankheit spielt. β-Amyloid (42-1), human TFA  Chemical Structure
  9. GC37986 β-Amyloid 1-17 β-Amyloid 1-17 ist ein Peptid von β-Amyloid, stabilisiert die Fasern und spielt eine Rolle bei der Aβ-Faserbildung. β-Amyloid 1-17  Chemical Structure
  10. GC37987 β-Amyloid 1-20 β-Amyloid 1-20 besteht aus den Aminosäuren 1 bis 20 des Beta-Amyloid-Proteins. β-Amyloid 1-20  Chemical Structure
  11. GC37993 β-Amyloid 1-9 β-Amyloid 1-9, ein N-terminales Fragment von Beta-Amyloid, besteht aus den Aminosäureresten 1 bis 9. β-Amyloid 1-9  Chemical Structure
  12. GC37985 β-Amyloid 11-22 β-Amyloid 11-22 ist ein Peptidfragment von β-Amyloid. β-Amyloid 11-22  Chemical Structure
  13. GC37988 β-Amyloid 12-20 β-Amyloid 12-20 ist ein Peptidfragment von β-Amyloid. β-Amyloid 12-20  Chemical Structure
  14. GC37991 β-Amyloid 15-21 β-Amyloid 15-21  Chemical Structure
  15. GC37992 β-Amyloid 18-28 β-Amyloid 18-28 ist ein Peptidfragment von β-Amyloid. β-Amyloid 18-28  Chemical Structure
  16. GC37994 β-Amyloid 22-40 β-Amyloid 22-40 ist ein Peptidfragment von β-Amyloid. β-Amyloid 22-40  Chemical Structure
  17. GC37995 β-Amyloid 33-40 β-Amyloid 33-40 ist ein Peptid, das aus den Aminosäuren 33 bis 40 des Beta-Amyloid-Proteins besteht. β-Amyloid 33-40  Chemical Structure
  18. GC37996 β-Amyloid 35-42 β-Amyloid 35-42 ist ein Peptid, das aus den Aminosäuren 35 bis 42 des Beta-Amyloid-Proteins besteht. β-Amyloid 35-42  Chemical Structure
  19. GC37997 β-Amyloid 4-10 β-Amyloid 4-10 ist ein Epitop für den polyklonalen Anti-Aβ(1-42)-Antikörper, reduziert die Amyloidablagerung in einem transgenen Mausmodell der Alzheimer-Krankheit. β-Amyloid 4-10  Chemical Structure
  20. GC34242 β-Amyloid (1-42), rat TFA β-Amyloid (1-42), rat TFA  Chemical Structure
  21. GC31146 β-Amyloid (10-35), amide β-Amyloid (10-35), Amid besteht aus 26 Aminosäuren (10-35 Reste des Aβ-Peptids) und ist der Hauptbestandteil der Amyloid-Plaques der Alzheimer-Krankheit. β-Amyloid (10-35), amide  Chemical Structure
  22. GC31129 β-Amyloid 1-16 (Amyloid β-Protein (1-16)) β-Amyloid 1-16 (Amyloid β-Protein (1-16)) ist ein &7#946;-Amyloid-Proteinfragment, das an der Metallbindung beteiligt ist. β-Amyloid 1-16 (Amyloid β-Protein (1-16))  Chemical Structure
  23. GC31171 β-Amyloid 1-28 (Amyloid β-Protein (1-28)) β-Amyloid 1-28 (Amyloid β-Protein (1-28)) ist ein &7#946;-Amyloid-Proteinfragment, das an der Metallbindung beteiligt ist. β-Amyloid 1-28 (Amyloid β-Protein (1-28))  Chemical Structure
  24. GC30325 β-Amyloid 22-35 (Amyloid β-Protein (22-35)) β-Amyloid 22-35 (Amyloid β-Protein 22-35), das Fragment der Reste 22-35 von β-Amyloid-Protein, hat eine zytotoxische Wirkung auf kultivierte Neuronen aus dem Hippocampus der Ratte in serumfreiem Medium. β-Amyloid 22-35 (Amyloid β-Protein (22-35))  Chemical Structure
  25. GC31137 β-Amyloid 29-40 (Amyloid beta-protein(29-40)) β-Amyloid 29-40 (Amyloid beta-protein(29-40)) ist ein Fragment von Amyloid-β Peptid. β-Amyloid 29-40 (Amyloid beta-protein(29-40))  Chemical Structure
  26. GC31179 β-Amyloid 31-35 β-Amyloid 31-35 ist die kürzeste Sequenz des nativen Amyloid-β-Peptids, das seine neurotoxische Aktivität behält. β-Amyloid 31-35  Chemical Structure
  27. GC16032 (R,S)-Anatabine (R,S)-Anatabin ist ein Tabakalkaloid in geringerer Menge, das in der Pflanzenfamilie der NachtschattengewÄchse vorkommt und als spezifischer Marker fÜr den Nachweis von Tabakkonsum verwendet werden kann. (R,S)-Anatabine  Chemical Structure
  28. GC16139 (R,S)-Anatabine (tartrate) Aβ inhibitor (R,S)-Anatabine (tartrate)  Chemical Structure
  29. GC30952 4-(6-Bromo-2-benzothiazolyl)-N-methylbenzenamine 4-(6-Brom-2-benzothiazolyl)-N-methylbenzolamin ist ein wirksames Amyloid-Bildgebungsmittel, das an Amyloid-β (1-40) mit einer KD von 1,7 nM bindet. 4-(6-Bromo-2-benzothiazolyl)-N-methylbenzenamine  Chemical Structure
  30. GC31208 4-(6-Bromo-2-benzothiazolyl)benzenamine 4-(6-Brom-2-benzothiazolyl)benzenamin ist ein β-Amyloid-PET (Positronen-Emissions-Tomographie)-Tracer, der bei der Diagnose von neurologischen Erkrankungen wie Alzheimer und Down-Syndrom verwendet werden kann. 4-(6-Bromo-2-benzothiazolyl)benzenamine  Chemical Structure
  31. GC63502 Aβ/tau aggregation-IN-1 Aβ/tau-Aggregation-IN-1 ist ein potenter Inhibitor der Aβ1-42 β-Faltblattbildung und Tau-Aggregation. Aβ/tau aggregation-IN-1  Chemical Structure
  32. GC66406 Aducanumab

    Aducanumab (BIIB037) ist ein humaner monoklonaler Antikörper, der selektiv für aggregierte Formen von Amyloid-Beta (Aβ) ist. Aducanumab zeigt eine Gehirnpenetration und kann für die Alzheimer-Forschung verwendet werden.

    Aducanumab  Chemical Structure
  33. GC31259 Aftin-4 Aftin-4 ist ein Induktor von Amyloid-β42 (Aβ42). Aftin-4  Chemical Structure
  34. GC65281 Aleplasinin Aleplasinin ist ein oral aktiver, potenter, BBB-penetrierter und selektiver SERPINE1 (PAI-1, Plasminogen activator inhibitor-1)-Inhibitor. Aleplasinin  Chemical Structure
  35. GC62834 ALZ-801 ALZ-801 ist ein wirksames und oral verfÜgbares niedermolekulares β-Amyloid (A⋲) Anti-Oligomer und Aggregationshemmer, Valin-konjugiertes Prodrug von Tramiprosat mit wesentlich verbesserten PK-Eigenschaften und gastrointestinaler VertrÄglichkeit im Vergleich zur Ausgangssubstanz. ALZ-801  Chemical Structure
  36. GC35334 Amyloid β Peptide (42-1)(human) Amyloid β Peptid (42-1) (Mensch) ist die inaktive Form von Amyloid β Peptid (1-42). Amyloid β Peptide (42-1)(human)  Chemical Structure
  37. GA20733 Amyloid β-Protein (1-42)

    Compared to the inner salt, the HCl salt of Aβ42 aggregates more readily at pH 7.4.

    Amyloid β-Protein (1-42)  Chemical Structure
  38. GA20730 Amyloid β-Protein (1-42) (HFIP-treated) H-7442 was obtained by dissolving Amyloid β-Protein (1-42) (H-1368) in HFIP, aliquoting, and removing the solvent as described in the literature. Amyloid β-Protein (1-42) (HFIP-treated)  Chemical Structure
  39. GA20736 Amyloid β-Protein (1-43) Amyloid β-Protein (1-43) ist anfÄlliger fÜr Aggregation und hat hÖhere toxische Eigenschaften als das seit langem bekannte A&7#946;1-42. Amyloid β-Protein (1-43)  Chemical Structure
  40. GP10099 amyloid A protein fragment [Homo sapiens] Apolipoproteins related to HDL in plasma amyloid A protein fragment [Homo sapiens]  Chemical Structure
  41. GP10118 Amyloid Beta-Peptide (1-40) (human)

    Amyloid β-Peptid (1-40) (human), (C194H295N53O58S1), ist ein Peptid mit der Sequenz H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid-Beta (Aβ oder Abeta) ist ein Peptid von 36–43 Aminosäuren, das aus dem Amyloid-Vorläuferprotein verarbeitet wird.

    Amyloid Beta-Peptide (1-40) (human)  Chemical Structure
  42. GP10049 Amyloid Beta-Peptide (12-28) (human)

    Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)).

    Amyloid Beta-Peptide (12-28) (human)  Chemical Structure
  43. GP10082 Amyloid Beta-peptide (25-35) (human)

    Amyloid-Beta-Peptid (25-35) (human) ist ein Fragment des Alzheimer Amyloid-Beta-Peptids, das neurotoxische Effekte hat.

    Amyloid Beta-peptide (25-35) (human)  Chemical Structure
  44. GC33160 amyloid P-IN-1 Amyloid P-IN-1 wird zur Erforschung von Krankheiten oder StÖrungen verwendet, bei denen die Serum-Amyloid-P-Komponente (SAP) erschÖpft ist, einschließlich Amyloidose, Alzheimer-Krankheit, Diabetes mellitus Typ 2 und Osteoarthritis. amyloid P-IN-1  Chemical Structure
  45. GP10046 Amyloid Precursor C-Terminal Peptide

    For beta amyloid generation

    Amyloid Precursor C-Terminal Peptide  Chemical Structure
  46. GP10057 Amyloid β-Peptide (10-20) (human) Amyloid β-Peptide (10-20) (human)  Chemical Structure
  47. GP10094 Amyloid β-peptide (10-35), amide Amyloid β-peptide (10-35), amide  Chemical Structure
  48. GP10097 Amyloid β-Protein (1-15) Amyloid β-Protein (1-15)  Chemical Structure
  49. GC39254 Anatabine dicitrate Anatabindicitrat ist ein Tabakalkaloid, das die Blut-Hirn-Schranke passieren kann. Anatabine dicitrate  Chemical Structure
  50. GC11309 ARN2966 ARN2966 ist ein potenter posttranskriptioneller Modulator der APP-Expression; reduziert die Expression von APP mit einer daraus resultierenden geringeren Produktion von Aβ. ARN2966  Chemical Structure
  51. GC19053 Azeliragon Azeliragon (TTP488) ist ein oral bioverfÜgbarer Inhibitor des Rezeptors fÜr fortgeschrittene Glykationsendprodukte (RAGE), der sich als potenzielle Behandlung zur Verlangsamung des Krankheitsverlaufs bei Patienten mit leichter Alzheimer-Krankheit (AD) in der Entwicklung befindet. Azeliragon  Chemical Structure
  52. GP10083 Beta-Amyloid (1-11) Beta-Amyloid (1-11)  Chemical Structure
  53. GC34232 Beta-Amyloid(1-14),mouse,rat Beta-Amyloid(1-14),mouse,rat  Chemical Structure
  54. GC31124 BF 227 BF 227 ist ein Kandidat fÜr eine Amyloid-Bildgebungssonde fÜr PET mit einem Ki von 4,3 nM fÜr Aβ1-42-Fibrillen. BF 227  Chemical Structure
  55. GC33750 BF-168 BF-168, eine Kandidatensonde fÜr PET, erkennt spezifisch sowohl neuritische als auch diffuse Plaques mit einem Ki von 6,4 nM fÜr Aβ1-42. BF-168  Chemical Structure
  56. GC15950 CGP 52411 CGP 52411 (DAPH) ist ein hochselektiver, potenter, oral aktiver und ATP-kompetitiver EGFR-Inhibitor mit einem IC50 von 0,3 μM. CGP 52411  Chemical Structure
  57. GC61887 Cl-NQTrp Cl-NQTrp unterbricht signifikant die vorgeformten fbrillaren Aggregate des von Tau abgeleiteten PHF6 (VQIVYK)-Peptids und des Tau-Proteins in voller LÄnge. Cl-NQTrp  Chemical Structure
  58. GC14854 Colivelin Colivelin ist ein in das Gehirn eindringendes neuroprotektives Peptid und ein starker Aktivator von STAT3, der den neuronalen Tod unterdrÜckt, indem es STAT3in vitro aktiviert. Colivelin  Chemical Structure
  59. GC35720 Colivelin TFA Colivelin TFA ist ein in das Gehirn eindringendes neuroprotektives Peptid und ein starker Aktivator von STAT3, der den neuronalen Tod durch Aktivierung von STAT3 in vitro unterdrÜckt. Colivelin TFA  Chemical Structure
  60. GC14828 CPHPC CPHPC ist ein Ligand fÜr die Serum-Amyloid-P-Komponente (SAP) und soll die SAP-Bindung an Amyloidfibrillen und -knÄuel hemmen und dissoziieren. CPHPC  Chemical Structure
  61. GC10230 CRANAD 2 CRANAD 2 ist eine Aβ-Plaque-spezifische Fluoreszenzsonde im nahen Infrarot (NIR). CRANAD 2  Chemical Structure
  62. GC12942 DAPT (GSI-IX)

    Inhibitor von γ-Sekretase

    DAPT (GSI-IX)  Chemical Structure
  63. GC50733 Davunetide Davunetid ist ein Ausschnitt aus acht AminosÄuren, der vom aktivitÄtsabhÄngigen neuroprotektiven Protein (ADNP) abgeleitet ist, einem neurotrophen Faktor, der im ZNS von SÄugetieren vorkommt. Davunetide  Chemical Structure
  64. GC13554 Deferoxamine mesylate

    Deferoxamin-Mesilat ist ein Medikament, das Eisen durch Bildung eines stabilen Komplexes chelatiert und verhindert, dass das Eisen in weitere chemische Reaktionen eingeht. Es wird zur Behandlung von chronischem Eisenüberladung bei Patienten mit transfusionsabhängiger Anämie eingesetzt.

    Deferoxamine mesylate  Chemical Structure
  65. GC13256 Dihydroergocristine mesylate Dihydroergocristinmesylat (DHEC-Mesylat) ist ein Inhibitor der γ-Sekretase (GSI), reduziert die Produktion der Amyloid-β-Peptide der Alzheimer-Krankheit, bindet direkt an γ-Sekretase und Nicastrin mit Gleichgewichtsdissoziationskonstanten (Kd) von 25,7 nM und 9,8 μM bzw.. Dihydroergocristine mesylate  Chemical Structure
  66. GC31083 DWK-1339 (MDR-1339) DWK-1339 (MDR-1339) (DWK-1339) ist ein oral aktiver und Blut-Hirn-Schranke-durchlÄssiger Aβ-Aggregationshemmer, der in der Erforschung der Alzheimer-Krankheit eingesetzt wird. DWK-1339 (MDR-1339)  Chemical Structure
  67. GC30823 Edonerpic maleate (T-817 maleate) Edonerpic-Maleat (T-817-Maleat) ist ein neuartiges neurotrophes Mittel, das Amyloid-β hemmen kann; Peptide (Aβ). Edonerpic maleate (T-817 maleate)  Chemical Structure
  68. GC10660 EHT 1864 EHT 1864 ist ein Inhibitor der kleinen GTPasen der Rac-Familie. EHT 1864  Chemical Structure
  69. GC10089 EUK 134 EUK 134, ein synthetisches Superoxid-Dismutase- und Katalase-Mimetikum, schützt Rattennieren vor Schäden durch Ischämie-Reperfusion. EUK 134  Chemical Structure
  70. GC62966 Ezeprogind disulfate Ezeprogind disulfate  Chemical Structure
  71. GC61476 Fmoc-Ala-Glu-Asn-Lys-NH2 Fmoc-Ala-Glu-Asn-Lys-NH2 ist ein selektives Asparagin-Endopeptidase (AEP)-Inhibitorpeptid und unterdrÜckt die Spaltung des Amyloid-VorlÄuferproteins (APP). Fmoc-Ala-Glu-Asn-Lys-NH2  Chemical Structure
  72. GC15105 FPS-ZM1

    Ein WUT-Hemmer

    FPS-ZM1  Chemical Structure
  73. GC36076 Frentizole Frentizol, ein von der FDA zugelassenes Immunsuppressivum, ist ein Aβ-ABAD (bindende Alkoholdehydrogenase)-Interaktionsinhibitor mit einem IC50-Wert von 200 μM. Frentizole  Chemical Structure
  74. GC36110 gamma-Secretase Modulators Gamma-Secretase Modulators (Hemmer der Amyloid-β-Produktion) ist ein Inhibitor der Amyloid-β-Produktion. gamma-Secretase Modulators  Chemical Structure
  75. GN10428 Geniposide Geniposide  Chemical Structure
  76. GN10307 Ginsenoside Re Ginsenoside Re  Chemical Structure
  77. GN10544 Ginsenoside Rg1

    Ginsenoside Rg1 is one of the main active ingredients of ginseng and a steroidal glycoside with various biological activities. Ginsenoside Rg1 reduces brain Aβ levels and reduces NF-κB nuclear translocation.

    Ginsenoside Rg1  Chemical Structure
  78. GN10614 Ginsenoside Rg2 Ginsenoside Rg2  Chemical Structure
  79. GN10799 Ginsenoside Rg3 Ginsenoside Rg3  Chemical Structure
  80. GC30892 Glutaminyl Cyclase Inhibitor 1 Glutaminylcyclase-Inhibitor 1 ist ein Glutaminylcyclase-Inhibitor mit einem IC50 von 0,5 μM. Glutaminyl Cyclase Inhibitor 1  Chemical Structure
  81. GC31110 Glutaminyl Cyclase Inhibitor 2 Glutaminylcyclase-Inhibitor 2 ist ein Glutaminylcyclase-Inhibitor mit einem IC50-Wert von 1,23 μM. Glutaminyl Cyclase Inhibitor 2  Chemical Structure
  82. GC36156 Glutaminyl Cyclase Inhibitor 3 Glutaminylcyclase-Inhibitor 3 (Verbindung 212), eine entwickelte Anti-Alzheimer-Verbindung, ist ein potenter humaner Glutaminylcyclase (GC)-Inhibitor mit einem IC50 von 4,5 nM. Glutaminyl Cyclase Inhibitor 3  Chemical Structure
  83. GC17657 Hoechst 34580

    The nucleic acid stain Hoechst 34580 (Ex/Em: 392/440 nm) is frequently utilized as a cell-permeable nuclear counterstain that emits a blue fluorescence upon binding to dsDNA.

    Hoechst 34580  Chemical Structure
  84. GC36247 Hoechst 34580 tetrahydrochloride Hoechst 34580 Tetrahydrochlorid ist ein zellgÄngiger Fluoreszenzfarbstoff zur FÄrbung von DNA und Zellkernen. Hoechst 34580 tetrahydrochloride  Chemical Structure
  85. GC10988 J 147 J 147 ist ein außergewöhnlich wirksames, oral aktives, neuroprotektives Mittel zur kognitiven Verbesserung. J 147  Chemical Structure
  86. GC30920 K 01-162 (K162) K 01-162 (K162) (K162) hemmt die Fibrillenbildung von Aβ Peptide und beseitigt ihre NeurotoxizitÄt. K 01-162 (K162)  Chemical Structure
  87. GC17974 Latrepirdine dihydrochloride Latrepirdin ist eine neuroaktive Verbindung mit antagonistischer AktivitÄt an histaminergen, α-adrenergen und serotonergen Rezeptoren. Latrepirdine dihydrochloride  Chemical Structure
  88. GC38628 Licochalcone B Licochalcone B  Chemical Structure
  89. GC12366 LPYFD-NH2 LPYFD-NH2, ein Pentapeptid, Übt eine gewisse Hemmwirkung auf die Aggregation von Aβ(1-42) aus. LPYFD-NH2  Chemical Structure
  90. GC30884 LX2343 LX2343 ist ein BACE1-Enzyminhibitor mit einem IC50-Wert von 11,43 ± 0,36 μM. LX2343  Chemical Structure
  91. GC10894 Methoxy-X04

    Fluoreszierende Amyloid-β (Aβ)-Sonde

    Methoxy-X04  Chemical Structure
  92. GC31285 MK-3328 MK-3328 ist ein β-Amyloid-PET-Ligand, der mit einer IC50 von 10,5 nM eine hohe BindungsstÄrke aufweist. MK-3328  Chemical Structure
  93. GN10695 Notoginsenoside R1 Notoginsenoside R1  Chemical Structure
  94. GC17037 NQTrp NQTrp, ein aromatisches Naphthochinon-Tryptophan-HybridmolekÜl, ein Inhibitor der Aggregation des Tau-Proteins mit generischer anti-amyloidogener Wirkung. NQTrp  Chemical Structure
  95. GC68377 OAB-14 OAB-14  Chemical Structure
  96. GC13783 Phenserine Phenserin ((-)-Eserolinphenylcarbamat) ist ein Derivat von Physostigmin und ist ein potenter, nicht kompetitiver, lang wirkender und selektiver AChE-Hemmer. Phenserine  Chemical Structure
  97. GC36954 PQM130 PQM130, ein Feruloyl-Donepezil-Hybrid-Wirkstoff mit Hirnpenetration, ist ein Multitarget-Medikamentenkandidat gegen die durch Aβ1-42-Oligomer (AβO) induzierte NeurotoxizitÄt und zeigt entzÜndungshemmende AktivitÄt. PQM130  Chemical Structure
  98. GC62702 RAGE antagonist peptide TFA Das RAGE-Antagonistenpeptid TFA ist ein Antagonist fÜr fortgeschrittene Glykationsendprodukte (RAGE). RAGE antagonist peptide TFA  Chemical Structure
  99. GC10425 Ro 90-7501 Ro 90-7501 ist ein Amyloid-β42 (Aβ42)-Fibrillenassemblierungsinhibitor, der die Aβ42-induzierte ZytotoxizitÄt (EC50 von 2 μM) reduziert. Ro 90-7501  Chemical Structure
  100. GC44856 Rutin (hydrate) Rutin (Rutosid) Trihydrat ist ein multifunktionales natÜrliches Flavonoid-Glykosid. Rutin (hydrate)  Chemical Structure
  101. GN10502 Saikosaponin C Saikosaponin C  Chemical Structure

Artikel 1 bis 100 von 114 gesamt

pro Seite
  1. 1
  2. 2

Absteigend sortieren