Search Site
  • 0
    장바구니

    Click Here to Find How Many Items You Have Added:)

    image loader

    Adding item(s) to cart......

홈 >> Signaling Pathways >> Neuroscience >> Amyloid β

Amyloid β

Amyloid β denotes peptides of 36–43 amino acids result from the APP (amyloid precursor protein) and are involved in Alzheimer's disease as the main component of the amyloid plaques.

Products for  Amyloid β

  1. Cat.No. 상품명 정보
  2. GC63273 β-Amyloid (1-14),mouse,rat β-Amyloid (1-14),mouse,rat Chemical Structure
  3. GC66089 β-Amyloid (1-40) (TFA) β-아밀로이드(1-40) TFA는 알츠하이머병 환자의 뇌에서 발견되는 플라크의 주요 단백질입니다.821d96072c2d58d8970e76f526b0f6b8 β-Amyloid (1-40) (TFA) Chemical Structure
  4. GC70182 β-Amyloid (1-40), FAM-labeled TFA

    β-아밀로이드 (1-40), FAM-TFA는 FAM 형광 표지가 된 β-아밀로이드 (1-40) 펩타이드입니다 (Λex= 492 nm 및 Λem= 518 nm)。

     β-Amyloid (1-40), FAM-labeled TFA Chemical Structure
  5. GC63274 β-Amyloid (1-42), (rat/mouse) (TFA) β-Amyloid (1-42), (rat/mouse) (TFA) Chemical Structure
  6. GC37984 β-Amyloid (1-42), rat β-아밀로이드(1-42), 쥐는 42-aa 펩타이드이며 급성 해마 조각에 대한 세포독성 효과를 나타내며 알츠하이머병 연구에 사용됩니다. β-Amyloid (1-42), rat Chemical Structure
  7. GC66416 β-Amyloid (22-35) (TFA) β-아밀로이드 22-35(아밀로이드 β-단백질 22-35) β-아밀로이드 단백질의 잔기 22-35 단편인 TFA는 무혈청 배지에서 래트 해마로부터 배양된 뉴런에 세포독성 효과를 갖는다. 821d96072c2d58d8970e76f526b0f6b8β-아밀로이드 22-35 TFA는 응집체를 형성하고 β-중성 완충액에서 아밀로이드 단백질과 유사한 전형적인 아밀로이드 원섬유를 형성합니다.821d96072c2d58d8970e76f526b0f6b8 β-Amyloid (22-35) (TFA) Chemical Structure
  8. GC66346 β-Amyloid (42-1), human TFA β- 아밀로이드(42-1), 인간 TFA는 아밀로이드의 불활성 형태인 β 821d96072c2d58d8970e76f526b0f6b8펩티드(1-42). 821d96072c2d58d8970e76f526b0f6b8β-아밀로이드(42-1), 인간 TFA는 알츠하이머병의 병인에서 중요한 역할을 하는 42-아미노산 펩티드입니다.821d96072c2d58d8970e76f526b0f6b8 β-Amyloid (42-1), human TFA Chemical Structure
  9. GC37986 β-Amyloid 1-17 β-Amyloid 1-17은 β-Amyloid의 펩타이드로, 섬유를 안정화시키고 Aβ 섬유 형성에 역할을 합니다. β-Amyloid 1-17 Chemical Structure
  10. GC37987 β-Amyloid 1-20 β-아밀로이드 1-20은 베타 아밀로이드 단백질의 아미노산 1에서 20으로 구성됩니다. β-Amyloid 1-20 Chemical Structure
  11. GC37993 β-Amyloid 1-9 β-베타 아밀로이드의 N-말단 단편인 아밀로이드 1-9는 아미노산 잔기 1에서 9로 구성됩니다. β-Amyloid 1-9 Chemical Structure
  12. GC37985 β-Amyloid 11-22 β-아밀로이드 11-22는 β-아밀로이드의 펩타이드 단편입니다. β-Amyloid 11-22 Chemical Structure
  13. GC37988 β-Amyloid 12-20 β-아밀로이드 12-20은 β-아밀로이드의 펩티드 단편입니다. β-Amyloid 12-20 Chemical Structure
  14. GC37991 β-Amyloid 15-21 β-Amyloid 15-21 Chemical Structure
  15. GC37992 β-Amyloid 18-28 β-아밀로이드 18-28은 β-아밀로이드의 펩티드 단편입니다. β-Amyloid 18-28 Chemical Structure
  16. GC37994 β-Amyloid 22-40 β-아밀로이드 22-40은 β-아밀로이드의 펩타이드 단편입니다. β-Amyloid 22-40 Chemical Structure
  17. GC37995 β-Amyloid 33-40 β-아밀로이드 33-40은 베타 아밀로이드 단백질의 아미노산 33~40으로 구성된 펩타이드입니다. β-Amyloid 33-40 Chemical Structure
  18. GC37996 β-Amyloid 35-42 β-아밀로이드 35-42는 베타 아밀로이드 단백질의 아미노산 35~42로 구성된 펩타이드입니다. β-Amyloid 35-42 Chemical Structure
  19. GC37997 β-Amyloid 4-10 β-아밀로이드 4-10은 다클론 항-Aβ(1-42) 항체에 대한 에피토프이며, 형질전환 알츠하이머병 마우스 모델에서 아밀로이드 침착을 감소시킵니다. β-Amyloid 4-10 Chemical Structure
  20. GC34242 β-Amyloid (1-42), rat TFA β-Amyloid (1-42), rat TFA Chemical Structure
  21. GC31146 β-Amyloid (10-35), amide β-아밀로이드(10-35), 아미드는 26개의 aa(Aβ 펩티드의 10-35개 잔기)로 구성되며 알츠하이머병의 아밀로이드 플라크의 주요 구성요소입니다. β-Amyloid (10-35), amide Chemical Structure
  22. GC31129 β-Amyloid 1-16 (Amyloid β-Protein (1-16)) &베타;-아밀로이드 1-16(아밀로이드 &베타;-단백질(1-16))은 β입니다.-아밀로이드 단백질 단편은 금속 결합에 관여합니다. β-Amyloid 1-16 (Amyloid β-Protein (1-16)) Chemical Structure
  23. GC31171 β-Amyloid 1-28 (Amyloid β-Protein (1-28)) &베타;-아밀로이드 1-28(아밀로이드 &베타;-단백질(1-28))은 β입니다.-아밀로이드 단백질 단편은 금속 결합에 관여합니다. β-Amyloid 1-28 (Amyloid β-Protein (1-28)) Chemical Structure
  24. GC30325 β-Amyloid 22-35 (Amyloid β-Protein (22-35)) β-아밀로이드 22-35(아밀로이드 ⋲-단백질 22-35), &7#8946의 잔기 22-35 단편. β-Amyloid 22-35 (Amyloid β-Protein (22-35)) Chemical Structure
  25. GC31137 β-Amyloid 29-40 (Amyloid beta-protein(29-40)) &베타;-아밀로이드 29-40(아밀로이드 베타-단백질(29-40))은 아밀로이드-β의 단편입니다. 펩타이드. β-Amyloid 29-40 (Amyloid beta-protein(29-40)) Chemical Structure
  26. GC31179 β-Amyloid 31-35 &베타;-아밀로이드 31-35는 신경독성 활성을 유지하는 천연 아밀로이드-β 펩티드의 가장 짧은 서열입니다. β-Amyloid 31-35 Chemical Structure
  27. GC16032 (R,S)-Anatabine (R,S)-Anatabine은 가지과 식물에서 발견되는 소량의 담배 알칼로이드로, 담배 사용 감지를 위한 특정 마커로 사용할 수 있습니다. (R,S)-Anatabine Chemical Structure
  28. GC16139 (R,S)-Anatabine (tartrate) Aβ inhibitor (R,S)-Anatabine (tartrate) Chemical Structure
  29. GC30952 4-(6-Bromo-2-benzothiazolyl)-N-methylbenzenamine 4-(6-브로모-2-벤조티아졸릴)-N-메틸벤젠아민은 1.7 nM의 KD로 아밀로이드-β(1-40)에 결합하는 강력한 아밀로이드 영상화제입니다. 4-(6-Bromo-2-benzothiazolyl)-N-methylbenzenamine Chemical Structure
  30. GC31208 4-(6-Bromo-2-benzothiazolyl)benzenamine 4-(6-Bromo-2-benzothiazolyl)benzenamine은 β-아밀로이드 PET(양전자방출단층촬영) 추적자로서 알츠하이머, 다운증후군과 같은 신경계 질환의 진단에 사용할 수 있습니다. 4-(6-Bromo-2-benzothiazolyl)benzenamine Chemical Structure
  31. GC63502 Aβ/tau aggregation-IN-1 Aβ/타우 응집-IN-1은 강력한 Aβ1-42 β-시트 형성 및 타우 응집 억제제입니다. Aβ/tau aggregation-IN-1 Chemical Structure
  32. GC66406 Aducanumab

    아두카누맙 (BIIB037)은 아밀로이드 베타(Aβ)의 집합체에 선택적으로 작용하는 인간 모노클로널 항체입니다. 아두카누맙은 뇌 내 침투성을 보이며, 알츠하이머병(AD) 연구에 사용될 수 있습니다.

     Aducanumab Chemical Structure
  33. GC31259 Aftin-4 Aftin-4는 Amyloid-β42(Aβ42) 유도제입니다. Aftin-4 Chemical Structure
  34. GC65281 Aleplasinin Aleplasinin은 경구 활성, 강력한 BBB 침투 및 선택적SERPINE1(PAI-1, Plasminogen Activator inhibitor-1) 억제제입니다. Aleplasinin Chemical Structure
  35. GC62834 ALZ-801 ALZ-801은 강력하고 경구로 이용 가능한 소분자 β-아밀로이드(Aβ) 항-올리고머 및 응집 억제제, 트라미프로세이트의 발린-접합 프로드럭으로, 모체의 PK 특성 및 위장 내약성과 비교하여 실질적으로 개선되었습니다. ALZ-801 Chemical Structure
  36. GC35334 Amyloid β Peptide (42-1)(human) 아밀로이드 β 펩티드(42-1)(인간)는 아밀로이드 β의 비활성 형태입니다. 펩티드(1-42). Amyloid β Peptide (42-1)(human) Chemical Structure
  37. GA20733 Amyloid β-Protein (1-42)

    Compared to the inner salt, the HCl salt of Aβ42 aggregates more readily at pH 7.4.

     Amyloid β-Protein (1-42) Chemical Structure
  38. GA20730 Amyloid β-Protein (1-42) (HFIP-treated) H-7442 was obtained by dissolving Amyloid β-Protein (1-42) (H-1368) in HFIP, aliquoting, and removing the solvent as described in the literature. Amyloid β-Protein (1-42) (HFIP-treated) Chemical Structure
  39. GA20736 Amyloid β-Protein (1-43) 아밀로이드 β-단백질(1-43)은 오래 동안 알려진 Aβ1-42보다 응집되기 쉽고 독성이 더 높습니다. Amyloid β-Protein (1-43) Chemical Structure
  40. GP10099 amyloid A protein fragment [Homo sapiens] Apolipoproteins related to HDL in plasma amyloid A protein fragment [Homo sapiens] Chemical Structure
  41. GP10118 Amyloid Beta-Peptide (1-40) (human)

    인간 Amyloid β-Peptide (1-40) (C194H295N53O58S1)은 H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH 시퀀스를 가진 펩타이드로, 분자량은 4329.8입니다. 아밀로이드 베타(Aβ 또는 Abeta)는 아밀로이드 전구 단백질에서 처리된 36~43개의 아미노산으로 이루어진 펩타이드입니다.

     Amyloid Beta-Peptide (1-40) (human) Chemical Structure
  42. GP10049 Amyloid Beta-Peptide (12-28) (human)

    Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)).

     Amyloid Beta-Peptide (12-28) (human) Chemical Structure
  43. GP10082 Amyloid Beta-peptide (25-35) (human)

    알츠하이머 아밀로이드 베타 펩타이드의 단편인 인간 Amyloid beta-peptide (25-35)은 신경독성 효과가 있습니다.

     Amyloid Beta-peptide (25-35) (human) Chemical Structure
  44. GC33160 amyloid P-IN-1 아밀로이드 P-IN-1은 아밀로이드증, 알츠하이머병, 2형 당뇨병 및 골관절염을 비롯한 혈청 아밀로이드 P 성분(SAP)이 고갈되는 질병 또는 장애의 연구에 사용됩니다. amyloid P-IN-1 Chemical Structure
  45. GP10046 Amyloid Precursor C-Terminal Peptide

    For beta amyloid generation

     Amyloid Precursor C-Terminal Peptide Chemical Structure
  46. GP10057 Amyloid β-Peptide (10-20) (human) Amyloid β-Peptide (10-20) (human) Chemical Structure
  47. GP10094 Amyloid β-peptide (10-35), amide Amyloid β-peptide (10-35), amide Chemical Structure
  48. GP10097 Amyloid β-Protein (1-15) Amyloid β-Protein (1-15) Chemical Structure
  49. GC39254 Anatabine dicitrate 아나타빈 구연산염은 혈뇌장벽을 통과할 수 있는 담배 알칼로이드입니다. Anatabine dicitrate Chemical Structure
  50. GC11309 ARN2966 ARN2966은 APP 발현의 강력한 전사 후 조절제입니다. APP의 발현을 감소시켜 결과적으로 Aβ의 더 낮은 생산을 감소시킨다. ARN2966 Chemical Structure
  51. GC19053 Azeliragon Azeliragon(TTP488)은 경증 알츠하이머병(AD) 환자의 질병 진행을 늦추기 위한 잠재적 치료제로 개발 중인 RAGE(Advanced glycation end products) 수용체의 경구 생체이용 억제제입니다. Azeliragon Chemical Structure
  52. GP10083 Beta-Amyloid (1-11) Beta-Amyloid (1-11) Chemical Structure
  53. GC34232 Beta-Amyloid(1-14),mouse,rat Beta-Amyloid(1-14),mouse,rat Chemical Structure
  54. GC31124 BF 227 BF 227은 Aβ1-42 원섬유에 대해 Ki가 4.3nM인 PET용 아밀로이드 이미징 프로브의 후보입니다. BF 227 Chemical Structure
  55. GC33750 BF-168 PET에 대한 후보 프로브인 BF-168은 Aβ1-42에 대해 6.4nM의 Ki로 신경염 및 미만성 플라크 모두를 특이적으로 인식하는 것으로 밝혀졌습니다. BF-168 Chemical Structure
  56. GC15950 CGP 52411 CGP 52411(DAPH)은 IC50이 0.3μM인 고선택성, 강력한 경구 활성 및 ATP 경쟁 EGFR 억제제입니다. CGP 52411 Chemical Structure
  57. GC61887 Cl-NQTrp Cl-NQTrp는 Tau 유래 PHF6(VQIVYK) 펩타이드와 전장 타우 단백질의 미리 형성된 원섬유 응집체를 현저하게 파괴합니다. Cl-NQTrp Chemical Structure
  58. GC14854 Colivelin Colivelin은 뇌 침투성 신경 보호 펩타이드이자 STAT3의 강력한 활성제이며 시험관 내에서 STAT3를 활성화하여 신경 세포 사멸을 억제합니다. Colivelin Chemical Structure
  59. GC35720 Colivelin TFA Colivelin TFA는 뇌 침투성 신경 보호 펩타이드이자 STAT3의 강력한 활성제이며 시험관 내에서 STAT3를 활성화하여 신경 세포 사멸을 억제합니다. Colivelin TFA Chemical Structure
  60. GC14828 CPHPC CPHPC는 혈청 아밀로이드 P 성분(SAP)에 대한 리간드이며 아밀로이드 원섬유 및 엉킴에 대한 SAP 결합을 억제 및 해리시키려는 의도입니다. CPHPC Chemical Structure
  61. GC10230 CRANAD 2 CRANAD 2는 근적외선(NIR) Aβ 플라크 특이적 형광 프로브입니다. CRANAD 2 Chemical Structure
  62. GC12942 DAPT (GSI-IX)

    γ-시크레타아제 억제제

     DAPT (GSI-IX) Chemical Structure
  63. GC50733 Davunetide Davunetide는 포유류 CNS에 존재하는 신경영양 인자인 활성 의존성 신경보호 단백질(ADNP)에서 파생된 8개의 아미노산 조각입니다. Davunetide Chemical Structure
  64. GC13554 Deferoxamine mesylate

    디페록사믹 메실레이트는 철분을 켈레이트하여 안정적인 복합체를 형성하여 철분이 추가적인 화학 반응에 참여하지 못하도록 방지하는 약물로, 수혈 의존성 빈혈 환자의 만성 철과부하 치료에 사용됩니다.

     Deferoxamine mesylate Chemical Structure
  65. GC13256 Dihydroergocristine mesylate Dihydroergocristine mesylate(DHEC mesylate)는 γ-secretase(GSI)의 억제제로, 알츠하이머병 아밀로이드-β 펩타이드의 생성을 감소시키며, 25.7nM 및 9.8μM의 평형 해리 상수(Kd)로 γ-secretase 및 Nicastrin에 직접 결합합니다. , 각각. Dihydroergocristine mesylate Chemical Structure
  66. GC31083 DWK-1339 (MDR-1339) DWK-1339(MDR-1339)(DWK-1339)는 알츠하이머병 연구에 사용되는 경구 활성 및 혈액 뇌 장벽 투과성 Aβ-응집 억제제입니다. DWK-1339 (MDR-1339) Chemical Structure
  67. GC30823 Edonerpic maleate (T-817 maleate) Edonerpic 말레산염(T-817 말레산염)은 아밀로이드-β을 억제할 수 있는 새로운 신경영양제입니다. 펩티드(Aβ). Edonerpic maleate (T-817 maleate) Chemical Structure
  68. GC10660 EHT 1864 EHT 1864는 Rac 계열 소형 GTPase의 억제제입니다. EHT 1864 Chemical Structure
  69. GC10089 EUK 134 합성 슈퍼옥사이드 디스뮤타제 및 카탈라제 모방체인 EUK 134는 허혈 재관류 유발 손상으로부터 쥐의 신장을 보호합니다. EUK 134 Chemical Structure
  70. GC62966 Ezeprogind disulfate Ezeprogind disulfate Chemical Structure
  71. GC61476 Fmoc-Ala-Glu-Asn-Lys-NH2 Fmoc-Ala-Glu-Asn-Lys-NH2는 선택적 아스파라긴 엔도펩티다제(AEP) 억제제 펩티드이며 아밀로이드 전구체 단백질(APP) 절단을 억제합니다. Fmoc-Ala-Glu-Asn-Lys-NH2 Chemical Structure
  72. GC15105 FPS-ZM1

    분노 억제제

     FPS-ZM1 Chemical Structure
  73. GC36076 Frentizole FDA 승인 면역억제제인 Frentizole은 IC50 값이 200μM인 Aβ-ABAD(결합 알코올 탈수소효소) 상호작용 억제제입니다. Frentizole Chemical Structure
  74. GC36110 gamma-Secretase Modulators gamma-Secretase Modulators(아밀로이드-β 생산 억제제)는 아밀로이드-β 생산 억제제입니다. gamma-Secretase Modulators Chemical Structure
  75. GN10428 Geniposide Geniposide Chemical Structure
  76. GN10307 Ginsenoside Re Ginsenoside Re Chemical Structure
  77. GN10544 Ginsenoside Rg1

    Ginsenoside Rg1 is one of the main active ingredients of ginseng and a steroidal glycoside with various biological activities. Ginsenoside Rg1 reduces brain Aβ levels and reduces NF-κB nuclear translocation.

     Ginsenoside Rg1 Chemical Structure
  78. GN10614 Ginsenoside Rg2 Ginsenoside Rg2 Chemical Structure
  79. GN10799 Ginsenoside Rg3 Ginsenoside Rg3 Chemical Structure
  80. GC30892 Glutaminyl Cyclase Inhibitor 1 글루타미닐 사이클라제 억제제 1은 IC50이 0.5μM인 글루타미닐 사이클라제 억제제입니다. Glutaminyl Cyclase Inhibitor 1 Chemical Structure
  81. GC31110 Glutaminyl Cyclase Inhibitor 2 글루타미닐 사이클라제 억제제 2는 IC50이 1.23μM인 글루타미닐 사이클라제 억제제입니다. Glutaminyl Cyclase Inhibitor 2 Chemical Structure
  82. GC36156 Glutaminyl Cyclase Inhibitor 3 설계된 항알츠하이머 화합물인 글루타미닐 사이클라제 억제제 3(화합물 212)은 IC50이 4.5nM인 강력한 인간 글루타미닐 사이클라제(GC) 억제제입니다. Glutaminyl Cyclase Inhibitor 3 Chemical Structure
  83. GC17657 Hoechst 34580

    The nucleic acid stain Hoechst 34580 (Ex/Em: 392/440 nm) is frequently utilized as a cell-permeable nuclear counterstain that emits a blue fluorescence upon binding to dsDNA.

     Hoechst 34580 Chemical Structure
  84. GC36247 Hoechst 34580 tetrahydrochloride Hoechst 34580 tetrahydrochloride는 DNA 및 핵 염색을 위한 세포 투과성 형광 염료입니다. Hoechst 34580 tetrahydrochloride Chemical Structure
  85. GC10988 J 147 J 147은 인지 향상을 위한 매우 강력한 경구 활성 신경 보호제입니다. J 147 Chemical Structure
  86. GC30920 K 01-162 (K162) K 01-162(K162)(K162)는 Aβ의 원섬유 형성을 억제하고; 펩티드를 제거하고 신경 독성을 제거합니다. K 01-162 (K162) Chemical Structure
  87. GC17974 Latrepirdine dihydrochloride 라트레피르딘은 히스타민성, ⋱-아드레날린성 및 세로토닌성 수용체에서 길항제 활성을 갖는 신경 활성 화합물입니다. Latrepirdine dihydrochloride Chemical Structure
  88. GC38628 Licochalcone B Licochalcone B Chemical Structure
  89. GC12366 LPYFD-NH2 펜타펩티드인 LPYFD-NH2는 Aβ(1-42)의 응집에 약간의 억제 효과를 발휘합니다. LPYFD-NH2 Chemical Structure
  90. GC30884 LX2343 LX2343은 IC50 값이 11.43±0.36μM인 BACE1 효소 억제제입니다. LX2343 Chemical Structure
  91. GC10894 Methoxy-X04

    형광 아밀로이드 β (Aβ) 프로브

     Methoxy-X04 Chemical Structure
  92. GC31285 MK-3328 MK-3328은 10.5nM의 IC50으로 높은 결합력을 나타내는 β-Amyloid PET 리간드입니다. MK-3328 Chemical Structure
  93. GN10695 Notoginsenoside R1 Notoginsenoside R1 Chemical Structure
  94. GC17037 NQTrp 방향족 나프토퀴논-트립토판 하이브리드 분자인 NQTrp는 일반적인 항아밀로이드 생성 효과가 있는 타우 단백질 응집 억제제입니다. NQTrp Chemical Structure
  95. GC68377 OAB-14 OAB-14 Chemical Structure
  96. GC13783 Phenserine 펜세린((-)-Eseroline phenylcarbamate)은 피소스티그민의 유도체이며 강력하고 비경쟁적이며 오래 지속되는 선택적 AChE 억제제입니다. Phenserine Chemical Structure
  97. GC36954 PQM130 페룰로일-도네페질 하이브리드(Feruloyl-Donepezil Hybrid) 화합물인 PQM130은 Aβ1-42 올리고머(AβO)에 의해 유발되는 신경독성에 대한 다중표적 약물 후보물질로 항염증 활성을 나타낸다. PQM130 Chemical Structure
  98. GC62702 RAGE antagonist peptide TFA RAGE 길항제 펩티드 TFA는 고급 당화 최종 생성물(RAGE) 길항제입니다. RAGE antagonist peptide TFA Chemical Structure
  99. GC10425 Ro 90-7501 Ro 90-7501은 Aβ42 유도 세포독성(EC50 2μM)을 감소시키는 아밀로이드 β42(Aβ42) 원섬유 조립 억제제입니다. Ro 90-7501 Chemical Structure
  100. GC44856 Rutin (hydrate) 루틴(Rutoside) 삼수화물은 다기능 천연 플라보노이드 배당체입니다. Rutin (hydrate) Chemical Structure
  101. GN10502 Saikosaponin C Saikosaponin C Chemical Structure

Items 1 to 100 of 114 total

페이지 당
  1. 1
  2. 2

내림차순