Search Site
  • 0
    My Cart

    Click Here to Find How Many Items You Have Added:)

    image loader

    Adding item(s) to cart......

Home >> Signaling Pathways >> Neuroscience >> Amyloid β

Amyloid β

Amyloid β denotes peptides of 36–43 amino acids result from the APP (amyloid precursor protein) and are involved in Alzheimer's disease as the main component of the amyloid plaques.

Products for  Amyloid β

  1. Cat.No. Product Name Information
  2. GC63273 β-Amyloid (1-14),mouse,rat β-Amyloid (1-14),mouse,rat Chemical Structure
  3. GC66089 β-Amyloid (1-40) (TFA)

    Amyloid Beta-Peptide (1-40) (human) TFA; Amyloid β-Peptide (1-40) (human) TFA

     β-Amyloid (1-40) TFA is a primary protein in plaques found in the brains of patients with Alzheimer's disease. β-Amyloid (1-40) (TFA) Chemical Structure
  4. GC70182 β-Amyloid (1-40), FAM-labeled TFA

    Beta-amyloid (1-40), FAM-labeled TFA is a FAM fluorescently labeled beta-amyloid (1-40) peptide (Λex= 492 nm and Λem= 518 nm).

     β-Amyloid (1-40), FAM-labeled TFA Chemical Structure
  5. GC63274 β-Amyloid (1-42), (rat/mouse) (TFA)

    Amyloid β-peptide (1-42) (rat/mouse) TFA

     β-Amyloid (1-42), (rat/mouse) (TFA) Chemical Structure
  6. GC37984 β-Amyloid (1-42), rat

    Amyloid β-peptide (1-42) (rat/mouse)

     β-Amyloid (1-42), rat is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease. β-Amyloid (1-42), rat Chemical Structure
  7. GC66416 β-Amyloid (22-35) (TFA)

    Amyloid β-Protein (22-35) (TFA)

     β-Amyloid 22-35 (Amyloid β-Protein 22-35) TFA, the residues 22-35 fragment ofβ-amyloid protein, has a cytotoxic effect on cultured neurons from the rat hippocampus in serum-free medium. β-Amyloid 22-35 TFA forms aggregates and typical amyloid fibrils resembling those of the β-amyloid protein in neutral buffer solution). β-Amyloid (22-35) (TFA) Chemical Structure
  8. GC66346 β-Amyloid (42-1), human TFA

    Amyloid β Peptide (42-1)(human) TFA

     β-Amyloid (42-1), human TFA is the inactive form of Amyloid β Peptide (1-42). β-Amyloid (42-1), human TFA is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease. β-Amyloid (42-1), human TFA Chemical Structure
  9. GC37986 β-Amyloid 1-17 β-Amyloid 1-17 is a peptide of β-Amyloid, stabilizes the fibres and plays a role in Aβ fibre formation. β-Amyloid 1-17 Chemical Structure
  10. GC37987 β-Amyloid 1-20 β-Amyloid 1-20 consists of amino acids 1 to 20 of beta amyloid protein. β-Amyloid 1-20 Chemical Structure
  11. GC37993 β-Amyloid 1-9 β-Amyloid 1-9, an N-terminal fragment of beta amyloid, consists of amino acid residues 1 to 9. β-Amyloid 1-9 Chemical Structure
  12. GC37985 β-Amyloid 11-22 β-Amyloid 11-22 is a peptide fragment of β-Amyloid. β-Amyloid 11-22 Chemical Structure
  13. GC37988 β-Amyloid 12-20 β-Amyloid 12-20 is a peptide fragment of β-Amyloid. β-Amyloid 12-20 Chemical Structure
  14. GC37991 β-Amyloid 15-21 β-Amyloid 15-21 Chemical Structure
  15. GC37992 β-Amyloid 18-28 β-Amyloid 18-28 is a peptide fragment of β-Amyloid. β-Amyloid 18-28 Chemical Structure
  16. GC37994 β-Amyloid 22-40 β-Amyloid 22-40 is a peptide fragment of β-Amyloid. β-Amyloid 22-40 Chemical Structure
  17. GC37995 β-Amyloid 33-40 β-Amyloid 33-40 is a peptide consisting of amino acid of 33 to 40 of beta amyloid protein. β-Amyloid 33-40 Chemical Structure
  18. GC37996 β-Amyloid 35-42 β-Amyloid 35-42 is a peptide consisting of amino acid of 35 to 42 of beta amyloid protein. β-Amyloid 35-42 Chemical Structure
  19. GC37997 β-Amyloid 4-10 β-Amyloid 4-10 is an epitope for the polyclonal anti-Aβ(1-42) antibody, reduces amyloid deposition in a transgenic Alzheimer disease mouse model. β-Amyloid 4-10 Chemical Structure
  20. GC34242 β-Amyloid (1-42), rat TFA β-Amyloid (1-42), rat TFA Chemical Structure
  21. GC31146 β-Amyloid (10-35), amide β-Amyloid (10-35), amide is composed of 26 aa (10-35 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer's disease. β-Amyloid (10-35), amide Chemical Structure
  22. GC31129 β-Amyloid 1-16 (Amyloid β-Protein (1-16))

    Amyloid β-Protein (1-16)

     β-Amyloid 1-16 (Amyloid β-Protein (1-16)) is a β-Amyloid protein fragment involved in metal binding. β-Amyloid 1-16 (Amyloid β-Protein (1-16)) Chemical Structure
  23. GC31171 β-Amyloid 1-28 (Amyloid β-Protein (1-28))

    Amyloid β-Protein (1-28)

     β-Amyloid 1-28 (Amyloid β-Protein (1-28)) is a β-Amyloid protein fragment involved in metal binding. β-Amyloid 1-28 (Amyloid β-Protein (1-28)) Chemical Structure
  24. GC30325 β-Amyloid 22-35 (Amyloid β-Protein (22-35)) β-Amyloid 22-35 (Amyloid β-Protein 22-35), the residues 22-35 fragment ofβ-amyloid protein, has a cytotoxic effect on cultured neurons from the rat hippocampus in serum-free medium. β-Amyloid 22-35 (Amyloid β-Protein (22-35)) Chemical Structure
  25. GC31137 β-Amyloid 29-40 (Amyloid beta-protein(29-40)) β-Amyloid 29-40 (Amyloid beta-protein(29-40)) is a fragment of Amyloid-β peptide. β-Amyloid 29-40 (Amyloid beta-protein(29-40)) Chemical Structure
  26. GC31179 β-Amyloid 31-35 β-Amyloid 31-35 is the shortest sequence of native Amyloid-β peptide that retains neurotoxic activity. β-Amyloid 31-35 Chemical Structure
  27. GC16032 (R,S)-Anatabine

    (±)-Anatabine

     Aβ inhibitor (R,S)-Anatabine Chemical Structure
  28. GC16139 (R,S)-Anatabine (tartrate)

    (±)-Anatabine

     Aβ inhibitor (R,S)-Anatabine (tartrate) Chemical Structure
  29. GC30952 4-(6-Bromo-2-benzothiazolyl)-N-methylbenzenamine 4-(6-Bromo-2-benzothiazolyl)-N-methylbenzenamine is a potent amyloid imaging agent which binds to Amyloid-β (1-40) with a KD of 1.7 nM. 4-(6-Bromo-2-benzothiazolyl)-N-methylbenzenamine Chemical Structure
  30. GC31208 4-(6-Bromo-2-benzothiazolyl)benzenamine 4-(6-Bromo-2-benzothiazolyl)benzenamine is a β-amyloid PET (positron emission tomography) tracer that can be used in the diagnosis of neurological diseases, such as Alzheimer's and Down's syndrome. 4-(6-Bromo-2-benzothiazolyl)benzenamine Chemical Structure
  31. GC63502 Aβ/tau aggregation-IN-1 Aβ/tau aggregation-IN-1 is a potent Aβ1-42 β-sheets formation and tau aggregation inhibitor. Aβ/tau aggregation-IN-1 Chemical Structure
  32. GC68721 Aβ/tau aggregation-IN-3

    Aβ/tau aggregation-IN-3 is an effective inhibitor of amyloid protein aggregation, with an IC50 of 0.85 μM as determined by Aβ-thioflavin T (Aβ-ThT) functional aggregation assay. It has anti-amyloid activity against Aβ and tau proteins.

     Aβ/tau aggregation-IN-3 Chemical Structure
  33. GC66406 Aducanumab

    BIIB037

     Aducanumab is a humanized IgG1 monoclonal antibody that specifically targets amyloid β (Aβ) aggregates, including soluble oligomers and fibrillar plaques. Aducanumab Chemical Structure
  34. GC31259 Aftin-4 An inducer of Aβ42 Aftin-4 Chemical Structure
  35. GC65281 Aleplasinin

    PAZ-417

     Aleplasinin is an orally active, potent, BBB-penetrated and selectiveSERPINE1 (PAI-1, Plasminogen activator inhibitor-1) inhibitor. Aleplasinin Chemical Structure
  36. GC62834 ALZ-801

    ALZ-801

     ALZ-801 is a potent and orally available small-molecule β-amyloid (Aβ) anti-oligomer and aggregation inhibitor, valine-conjugated prodrug of Tramiprosate with substantially improved PK properties and gastrointestinal tolerability compared with the parent compound. ALZ-801 Chemical Structure
  37. GC35334 Amyloid β Peptide (42-1)(human) Amyloid β Peptide (42-1)(human) is the inactive form of Amyloid β Peptide (1-42). Amyloid β Peptide (42-1)(human) Chemical Structure
  38. GA20733 Amyloid β-Protein (1-42)

    Compared to the inner salt, the HCl salt of Aβ42 aggregates more readily at pH 7.4.

     Amyloid β-Protein (1-42) Chemical Structure
  39. GA20736 Amyloid β-Protein (1-43) Amyloid β-Protein (1-43) is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. Amyloid β-Protein (1-43) Chemical Structure
  40. GP10099 amyloid A protein fragment [Homo sapiens]

    H2N-Ala-Gly-Leu-Pro-Glu-Lys-Tyr-OH

    Apolipoproteins related to HDL in plasma amyloid A protein fragment [Homo sapiens] Chemical Structure
  41. GP10118 Amyloid Beta-Peptide (1-40) (human)

    Amyloid β-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (Aβ or Abeta) is a peptide of 36–43 amino acids that is processed from the Amyloid precursor protein.

     Amyloid Beta-Peptide (1-40) (human) Chemical Structure
  42. GP10049 Amyloid Beta-Peptide (12-28) (human) Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)). Amyloid Beta-Peptide (12-28) (human) Chemical Structure
  43. GP10082 Amyloid Beta-peptide (25-35) (human) Amyloid beta(Aβ)-peptide (25-35) (human) is an fragment of Alzheimer's Amyloid beta peptide which is commonly found in the brains of people with Alzheimer's disease (AD) and is a major component of Alzheimer's amyloid plaques. Amyloid Beta-peptide (25-35) (human) Chemical Structure
  44. GC33160 amyloid P-IN-1 amyloid P-IN-1 is used in the research of diseases or disorders wherein depletion of serum amyloid P component (SAP), including amyloidosis, Alzheimer's disease, type 2 diabetes mellitus and osteoarthritis. amyloid P-IN-1 Chemical Structure
  45. GP10046 Amyloid Precursor C-Terminal Peptide

    H2N-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH

    For beta amyloid generation

     Amyloid Precursor C-Terminal Peptide Chemical Structure
  46. GP10057 Amyloid β-Peptide (10-20) (human)

    Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe

    Amyloid β-Peptide (10-20) (human) Chemical Structure
  47. GP10094 Amyloid β-peptide (10-35), amide

    H2N-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-NH2

    Amyloid β-peptide (10-35), amide Chemical Structure
  48. GP10097 Amyloid β-Protein (1-15)

    H2N-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-OH

    Amyloid β-Protein (1-15) Chemical Structure
  49. GC39254 Anatabine dicitrate Anatabine dicitrate is a tobacco alkaloid that can cross the blood-brain barrier. Anatabine dicitrate Chemical Structure
  50. GC11309 ARN2966

    2-PMAP

    APP expression modulator

     ARN2966 Chemical Structure
  51. GC68714 AZD4694

    NAV4694

    AZD4694 (NAV4694) is a PET radioligand for imaging amyloid-beta (Aβ) plaques in the brain, with high affinity for Aβ fibers (Kd = 2.3 nM).

     AZD4694 Chemical Structure
  52. GC19053 Azeliragon TTP488 is an antagonist at the Receptor for Advanced Glycation End products, is evaluated as a potential treatment for patients with mild-to-moderate Alzheimer's disease (AD). Azeliragon Chemical Structure
  53. GC68725 Bapineuzumab

    Bapineuzumab is a monoclonal antibody that targets beta-amyloid protein (APP). It can be used in the research of Alzheimer's disease (AD).

     Bapineuzumab Chemical Structure
  54. GP10083 Beta-Amyloid (1-11)

    H2N-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-OH

    Beta-Amyloid (1-11) Chemical Structure
  55. GC34232 Beta-Amyloid(1-14),mouse,rat Beta-Amyloid(1-14),mouse,rat Chemical Structure
  56. GC31124 BF 227

    BF 227 is a candidate for an amyloid imaging probe for PET, with a Ki of 4.3 nM for Aβ1-42 fibrils.

     BF 227 Chemical Structure
  57. GC33750 BF-168 BF-168, a candidate probe for PET, is found to specifically recognize both neuritic and diffuse plaques, with a Ki of 6.4 nM for Aβ1-42. BF-168 Chemical Structure
  58. GC15950 CGP 52411

    CGP 52411, 4,5-Dianilinophthalimide

     EGFR inhibitor CGP 52411 Chemical Structure
  59. GC61887 Cl-NQTrp Cl-NQTrp signifcantly disrupts the preformed fbrillar aggregates of Tau-derived PHF6 (VQIVYK) peptide and full-length tau protein. Cl-NQTrp Chemical Structure
  60. GC14854 Colivelin Colivelin (CLN) is A brain-permeable neuroprotective peptide that has effective long-term effects on Aβ deposition, neuronal apoptosis and synaptic plasticity defects in neurodegenerative diseases. Colivelin Chemical Structure
  61. GC35720 Colivelin TFA Colivelin TFA is a brain penetrant neuroprotective peptide and a potent activator of STAT3, suppresses neuronal death by activating STAT3?in vitro. Colivelin TFA Chemical Structure
  62. GC14828 CPHPC

    Ro 63-8695|GSK2315698

     CPHPC is a ligand for serum amyloid P component (SAP) and intends to inhibit and dissociate SAP binding to amyloid fibrils and tangles. CPHPC Chemical Structure
  63. GC10230 CRANAD 2 near-infrared probe that binds to Aβ40 aggregates CRANAD 2 Chemical Structure
  64. GC12942 DAPT (GSI-IX)

    gamma-Secretase Inhibitor IX, DAPT, GSI-IX

     DAPT (GSI-IX) is an orally active γ-secretase inhibitor with IC50s of 115 nM and 200 nM for total amyloid-β (Aβ) and Aβ42 produced in human primary neuronal cultures, respectively. DAPT (GSI-IX) Chemical Structure
  65. GC50733 Davunetide Davunetide is an eight amino acid snippet derived from activity-dependent neuroprotective protein (ADNP), a neurotrophic factor that exists in the mammalian CNS. Davunetide Chemical Structure
  66. GC13554 Deferoxamine mesylate

    Ba 33112, DFO, DFOM, DFX, NSC 644468

    Deferoxamine mesylate is a drug that chelates iron by forming a stable complex that prevents the iron from entering into further chemical reactions, and is used for the treatment of chronic iron overload in patients with transfusion-dependent anemias.

     Deferoxamine mesylate Chemical Structure
  67. GC13256 Dihydroergocristine mesylate

    5-HT receptor antagonist and partial agonist of adrenergic and dopaminergic receptors

     Dihydroergocristine mesylate Chemical Structure
  68. GC68996 Donanemab

    LY3002813

    Donanemab (LY3002813) is a humanized IgG1 monoclonal antibody targeting the N-terminal pyroglutamate of beta-amyloid (Aβ) epitope. Donanemab has potential for early Alzheimer's disease research.

     Donanemab Chemical Structure
  69. GC31083 DWK-1339 (MDR-1339)

    MDR-1339

     DWK-1339 (MDR-1339) (DWK-1339) is an orally active and blood-brain-barrier-permeable Aβ-aggregation inhibitor, used in the research of Alzheimer's disease. DWK-1339 (MDR-1339) Chemical Structure
  70. GC30823 Edonerpic maleate (T-817 maleate)

    T-187MA

     T-817MA [1-{3-[2-(1-Benzothiophen-5-yl)ethoxy] propyl}-3-azetidinol maleate] is a newly synthesized agent for Alzheimer's disease (AD) treatment with neuroprotective effects against toxicity from amyloid-β peptide (Aβ) and actions promoting neurite outgrowth. Edonerpic maleate (T-817 maleate) Chemical Structure
  71. GC10660 EHT 1864 Rac family small GTPases inhibitor EHT 1864 Chemical Structure
  72. GC10089 EUK 134 Salen-manganese complexes;SOD mimetic EUK 134 Chemical Structure
  73. GC62966 Ezeprogind disulfate Ezeprogind disulfate Chemical Structure
  74. GC61476 Fmoc-Ala-Glu-Asn-Lys-NH2 Fmoc-Ala-Glu-Asn-Lys-NH2 is a selective asparagine endopeptidase (AEP) inhibitor peptide and suppresses amyloid precursor protein (APP) cleavage. Fmoc-Ala-Glu-Asn-Lys-NH2 Chemical Structure
  75. GC15105 FPS-ZM1

    RAGE Antagonist

     A RAGE Inhibitor FPS-ZM1 Chemical Structure
  76. GC36076 Frentizole Frentizole, an FDA-approved immunosuppressant, is a Aβ-ABAD (binding alcohol dehydrogenase) interaction inhibitor with an IC50 value of 200 μM. Frentizole Chemical Structure
  77. GC36110 gamma-Secretase Modulators gamma-Secretase Modulators (Amyloid-β production inhibitor) is a Amyloid-β production inhibitor. gamma-Secretase Modulators Chemical Structure
  78. GC69150 Gantenerumab

    Gantenerumab is a fully human monoclonal antibody against amyloid-beta (Aβ) of the IgG1 class, which shows sustained binding to brain amyloid-beta. Gantenerumab can be used for Alzheimer's disease research.

     Gantenerumab Chemical Structure
  79. GN10428 Geniposide Geniposide Chemical Structure
  80. GN10307 Ginsenoside Re

    Chikusetsusaponin IVc, NSC 308877, Panaxoside Re, Sanchinoside Re

     Ginsenoside Re Chemical Structure
  81. GN10544 Ginsenoside Rg1

    Ginsenoside A2, Panaxoside A, Panaxoside Rg1, Sanchinoside C1, Sanchinoside Rg1

     Ginsenoside Rg1, one of the main active components found in Panax ginseng, is a class of natural products known as steroid glycosides with a wide range of biological activities. Ginsenoside Rg1 Chemical Structure
  82. GN10614 Ginsenoside Rg2

    Chikusetsusaponin I, Panaxoside Rg2, Prosapogenin C2

     Ginsenoside Rg2 Chemical Structure
  83. GN10799 Ginsenoside Rg3

    20(S)-Propanaxadiol

     Ginsenoside Rg3 Chemical Structure
  84. GC30892 Glutaminyl Cyclase Inhibitor 1 Glutaminyl Cyclase Inhibitor 1 is a glutaminyl cyclase inhibitor with an IC50 of 0.5 μM. Glutaminyl Cyclase Inhibitor 1 Chemical Structure
  85. GC31110 Glutaminyl Cyclase Inhibitor 2 Glutaminyl Cyclase Inhibitor 2 is a glutaminyl cyclase inhibitor with an IC50 of 1.23 μM. Glutaminyl Cyclase Inhibitor 2 Chemical Structure
  86. GC36156 Glutaminyl Cyclase Inhibitor 3 Glutaminyl Cyclase Inhibitor 3 (compound 212 ), a designed anti-Alzheimer’s compound, is a potent human Glutaminyl Cyclase (GC) inhibitor, with an IC50 of 4.5 nM. Glutaminyl Cyclase Inhibitor 3 Chemical Structure
  87. GC17657 Hoechst 34580

    HOE 34580;Proamine;Hoechst-34580;Hoechst34580

    The nucleic acid stain Hoechst 34580 (Ex/Em: 392/440 nm) is frequently utilized as a cell-permeable nuclear counterstain that emits a blue fluorescence upon binding to dsDNA.

     Hoechst 34580 Chemical Structure
  88. GC36247 Hoechst 34580 tetrahydrochloride

    HOE 34580 tetrahydrochloride

    Hoechst 34580 tetrahydrochloride is a Hoechst series dye that is commonly used for nuclear labeling staining of living cells.

     Hoechst 34580 tetrahydrochloride Chemical Structure
  89. GC10988 J 147 reduces soluble Aβ40 and Aβ42 levels J 147 Chemical Structure
  90. GC30920 K 01-162 (K162)

    K162

     K 01-162 (K162) (K162) inhibits the fibril formation of Aβ peptides and eliminates their neurotoxicity. K 01-162 (K162) Chemical Structure
  91. GC17974 Latrepirdine dihydrochloride

    Dimebon, Latrepirdine

     Latrepirdine is a neuroactive compound with antagonist activity at histaminergic, α-adrenergic, and serotonergic receptors. Latrepirdine dihydrochloride Chemical Structure
  92. GC38628 Licochalcone B Licochalcone B Chemical Structure
  93. GC12366 LPYFD-NH2 neuroprotective peptide that binds to amyloid beta (Aβ) LPYFD-NH2 Chemical Structure
  94. GC30884 LX2343 An inhibitor of BACE1 and PI3K LX2343 Chemical Structure
  95. GC10894 Methoxy-X04

    Methoxy-X04 is a fluorescent derivative of Congo Red and Thioflavin T, lacking acidic groups, with a smaller molecular weight and increased lipophilicity.

     Methoxy-X04 Chemical Structure
  96. GC31285 MK-3328 MK-3328 is a β-Amyloid PET ligand, which exhibits high binding potency with an IC50 of 10.5 nM. MK-3328 Chemical Structure
  97. GN10695 Notoginsenoside R1

    Sanchinoside R1

     Notoginsenoside R1 Chemical Structure
  98. GC17037 NQTrp

    1,4-Naphthoquinon-2-yl-L-tryptophan

     inhibitor of Alzheimer’s disease-associated amyloid β (Aβ) oligomerization and fibrillization NQTrp Chemical Structure
  99. GC68377 OAB-14 OAB-14 Chemical Structure
  100. GC13783 Phenserine

    (-)-Eseroline phenylcarbamate, (-)-N-Phenylcarbamoyleseroline, (-)-Phenserine

     acetylcholinesterase inhibitor Phenserine Chemical Structure
  101. GC36954 PQM130 PQM130, a Feruloyl-Donepezil Hybrid compound with brain penatration, is a multitarget drug candidate against the neurotoxicity induced by Aβ1-42 oligomer (AβO) and shows anti-inflammatory activity. PQM130 Chemical Structure

Items 1 to 100 of 118 total

per page
  1. 1
  2. 2

Set Descending Direction