Search Site
  • 0
    My Cart

    Click Here to Find How Many Items You Have Added:)

    image loader

    Adding item(s) to cart......

Home >> Signaling Pathways >> Others >> Miscellaneous Compounds

Miscellaneous Compounds

Products for  Miscellaneous Compounds

  1. Cat.No. Product Name Information
  2. GC10703 A 1120 retinol-binding protein 4 (RBP4) ligand A 1120 Chemical Structure
  3. GC17953 CP 20961

    CP 20,961

     non-immunogenic adjuvant CP 20961 Chemical Structure
  4. GC12969 Deoxynivalenol

    4-deoxy Nivalenol

    Deoxynivalenol (DON) is a high-toxicity secondary metabolite produced by Fusarium graminearum.

     Deoxynivalenol Chemical Structure
  5. GC11088 GYY 4137 morpholine salt GYY 4137 morpholine salt is a novel slow-release hydrogen sulfide (H2S) donor with vasodilatory, antihypertensive, anti-inflammatory, and anticancer activities. GYY 4137 morpholine salt Chemical Structure
  6. GC14377 LL-37 (trifluoroacetate salt)

    CAP-18, hCAP-18, Cathelicidin, FALL-39

     LL-37 contains 37 amino acid residues with the first two leucine residues (L1LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES37) and mostly exists in epithelial cells and neutrophils. LL-37 (trifluoroacetate salt) Chemical Structure
  7. GC13228 Phosphocreatine disodium salt Phosphocreatine disodium salt is a crucial energy store in tissues with high, fluctuating energy demands like muscle and brain. Phosphocreatine disodium salt Chemical Structure
  8. GC16952 SB 204990 SB 204990, a lactone prodrug, potently inhibits ATP citrate-lyase. SB 204990 Chemical Structure
  9. GC10682 TAS 301

    inhibitor of smooth muscle cell migration and proliferation, inhibits PKC signaling

     TAS 301 Chemical Structure
  10. GC15699 TMN 355 cyclophilin A inhibitor TMN 355 Chemical Structure

9 Item(s)

per page

Set Descending Direction