Search Site
  • 0
    My Cart

    Click Here to Find How Many Items You Have Added:)

    image loader

    Adding item(s) to cart......

Home >> Signaling Pathways >> Others >> Miscellaneous Compounds

Miscellaneous Compounds

Products for  Miscellaneous Compounds

  1. Cat.No. Product Name Information
  2. GC10703 A 1120 retinol-binding protein 4 (RBP4) ligand A 1120 Chemical Structure
  3. GC17953 CP 20961

    CP 20,961

     non-immunogenic adjuvant CP 20961 Chemical Structure
  4. GC12969 Deoxynivalenol

    4-deoxy Nivalenol

    Deoxynivalenol (DON) is a high-toxicity secondary metabolite produced by Fusarium graminearum.

     Deoxynivalenol Chemical Structure
  5. GC11088 GYY 4137 morpholine salt GYY 4137 morpholine salt is a novel slow-release hydrogen sulfide (H2S) donor with vasodilatory, antihypertensive, anti-inflammatory, and anticancer activities. GYY 4137 morpholine salt Chemical Structure
  6. GC14377 LL-37 (trifluoroacetate salt)

    CAP-18, hCAP-18, Cathelicidin, FALL-39

     LL-37 contains 37 amino acid residues with the first two leucine residues (L1LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES37) and mostly exists in epithelial cells and neutrophils. LL-37 (trifluoroacetate salt) Chemical Structure
  7. GC13228 Phosphocreatine disodium salt Phosphocreatine disodium salt, one of organic compounds known as alpha amino acids and derivatives, is a substrate for the determination of creatine kinase and used to regenerate ATP during skeletal muscle contraction. Phosphocreatine disodium salt Chemical Structure
  8. GC16952 SB 204990 ATP citrate lyase (ACLY) inhibitor SB 204990 Chemical Structure
  9. GC10682 TAS 301

    inhibitor of smooth muscle cell migration and proliferation, inhibits PKC signaling

     TAS 301 Chemical Structure
  10. GC15699 TMN 355 cyclophilin A inhibitor TMN 355 Chemical Structure

9 Item(s)

per page

Set Descending Direction