>> Signaling Pathways >> Neuroscience

Neuroscience

Neuroscience

Neuroscience

Neurons communicate with each other, effector organs and sensory organs through the neurotransmitter – receptor pathway at synapses. Neurotransmitters can be divided into 4 major groups: 1. Amino acids (glumate, aspartate, serine, glycine and GABA); 2. Monoamines (norepinephrine, epinephrine, dopamine, histamine, and serotonin); 3. Peptides (opioid peptides, substance P, somatostatin); and 4. Others (acetylcholine, NO, nucleosides).

Targets for  Neuroscience

Products for  Neuroscience

  1. Cat.No. 상품명 정보
  2. GC34064 Aminooxyacetic acid hemihydrochloride (Carboxymethoxylamine Hemihydrochloride) 아미노옥시아세트산(카복시메톡시아민) 헤미하이드로클로라이드는 GABA 분해 효소인 GABA-T도 억제하는 말레이트-아스파테이트 셔틀(MAS) 억제제입니다. Aminooxyacetic acid hemihydrochloride (Carboxymethoxylamine Hemihydrochloride)  Chemical Structure
  3. GC16052 Aminopotentidine H2 antagonist Aminopotentidine  Chemical Structure
  4. GC12610 Amisulpride Amisulpride는 인간 도파민 D2 및 D3에 대해 각각 2.8 및 3.2nM의 Kis를 갖는 도파민 D2/D3 수용체 길항제입니다. Amisulpride  Chemical Structure
  5. GC35323 Amisulpride hydrochloride Amisulpride hydrochloride는 인간 도파민 D2 및 D3에 대해 각각 2.8 및 3.2nM의 Kis를 갖는 도파민 D2/D3 수용체 길항제입니다. Amisulpride hydrochloride  Chemical Structure
  6. GC52004 Amisulpride N-oxide A degradation product of amisulpride Amisulpride N-oxide  Chemical Structure
  7. GC46843 Amisulpride-d5 An internal standard for the quantification of amisulpride Amisulpride-d5  Chemical Structure
  8. GC30981 Amitifadine hydrochloride (DOV-21947 hydrochloride) 아미티파딘 염산염(DOV-21947 염산염)은 세로토닌-노르에피네프린-도파민 재흡수 억제제(SNDRI)이며, HEK 293 세포에서 세로토닌, 노르에피네프린 및 도파민에 대한 IC50이 각각 12, 23, 96 nM입니다. Amitifadine hydrochloride (DOV-21947 hydrochloride)  Chemical Structure
  9. GC33983 Amitraz (BTS-27419) Amitraz(BTS-27419)는 알파-아드레날린 작용제 활성, 중추신경계의 옥토파민 수용체와의 상호작용 및 모노아민 산화효소 및 프로스타글란딘 합성 억제를 갖는 비-전신 살비제 및 살충제입니다. Amitraz (BTS-27419)  Chemical Structure
  10. GC25060 Amitriptyline Amitriptyline (MK-230, N-750, Ro41575) is a tricyclic antidepressant (TCA) with analgesic properties, widely used to treat depression and neuropathic pain. Amitriptyline is an inhibitor of both serotonin transporter (SERT) and norepinephrine transporter (NET) with Ki of 3.45 nM and 13.3 nM, respectively. Amitriptyline also inhibits histamine receptor H1, histamine receptor H4, 5-HT2 and sigma 1 receptor with Ki of 0.5 nM, 7.31 nM, 235 nM and 287 nM, respectively. This product is a waxy solid. Amitriptyline  Chemical Structure
  11. GC13723 Amitriptyline HCl Amitriptyline HCl은 인간 SERT 및 NET에 대해 각각 3.45nM 및 13.3nM의 Kis를 갖는 세로토닌 재흡수 수송체(SERT) 및 노르아드레날린 재흡수 수송체(NET)의 억제제입니다. Amitriptyline HCl  Chemical Structure
  12. GC49336 AMK (hydrochloride) An active metabolite of melatonin AMK (hydrochloride)  Chemical Structure
  13. GC11287 AMN 082 dihydrochloride AMN 082 dihydrochloride는 선택적 경구 활성 및 뇌 침투 mGluR7 작용제이며 막 횡단 도메인의 알로스테릭 부위를 통해 수용체 신호 전달을 직접 활성화합니다. AMN 082 dihydrochloride  Chemical Structure
  14. GC68438 AMPA receptor modulator-3 AMPA receptor modulator-3  Chemical Structure
  15. GC14104 Ampiroxicam Ampiroxicam(CP65703)은 항염증제로 사용되는 비선택적 cyclooxygenase inhibitor이다. Ampiroxicam  Chemical Structure
  16. GC33484 Ampyrone (4-Aminoantipyrine) Ampyrone (4-Aminoantipyrine)  Chemical Structure
  17. GC12472 Amthamine dihydrobromide H2 agonist Amthamine dihydrobromide  Chemical Structure
  18. GC42796 Amylin (human) (trifluoroacetate salt) Amylin is a 37-residue peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety. Amylin (human) (trifluoroacetate salt)  Chemical Structure
  19. GC35334 Amyloid β Peptide (42-1)(human) 아밀로이드 β 펩티드(42-1)(인간)는 아밀로이드 β의 비활성 형태입니다. 펩티드(1-42). Amyloid β Peptide (42-1)(human)  Chemical Structure
  20. GA20733 Amyloid β-Protein (1-42)

    Compared to the inner salt, the HCl salt of Aβ42 aggregates more readily at pH 7.4.

    Amyloid β-Protein (1-42)  Chemical Structure
  21. GA20730 Amyloid β-Protein (1-42) (HFIP-treated) H-7442 was obtained by dissolving Amyloid β-Protein (1-42) (H-1368) in HFIP, aliquoting, and removing the solvent as described in the literature. Amyloid β-Protein (1-42) (HFIP-treated)  Chemical Structure
  22. GA20736 Amyloid β-Protein (1-43) 아밀로이드 β-단백질(1-43)은 오래 동안 알려진 Aβ1-42보다 응집되기 쉽고 독성이 더 높습니다. Amyloid β-Protein (1-43)  Chemical Structure
  23. GP10099 amyloid A protein fragment [Homo sapiens] Apolipoproteins related to HDL in plasma amyloid A protein fragment [Homo sapiens]  Chemical Structure
  24. GP10118 Amyloid Beta-Peptide (1-40) (human)

    인간 Amyloid β-Peptide (1-40) (C194H295N53O58S1)은 H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH 시퀀스를 가진 펩타이드로, 분자량은 4329.8입니다. 아밀로이드 베타(Aβ 또는 Abeta)는 아밀로이드 전구 단백질에서 처리된 36~43개의 아미노산으로 이루어진 펩타이드입니다.

    Amyloid Beta-Peptide (1-40) (human)  Chemical Structure
  25. GP10049 Amyloid Beta-Peptide (12-28) (human)

    Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)).

    Amyloid Beta-Peptide (12-28) (human)  Chemical Structure
  26. GP10082 Amyloid Beta-peptide (25-35) (human)

    알츠하이머 아밀로이드 베타 펩타이드의 단편인 인간 Amyloid beta-peptide (25-35)은 신경독성 효과가 있습니다.

    Amyloid Beta-peptide (25-35) (human)  Chemical Structure
  27. GC33160 amyloid P-IN-1 아밀로이드 P-IN-1은 아밀로이드증, 알츠하이머병, 2형 당뇨병 및 골관절염을 비롯한 혈청 아밀로이드 P 성분(SAP)이 고갈되는 질병 또는 장애의 연구에 사용됩니다. amyloid P-IN-1  Chemical Structure
  28. GP10046 Amyloid Precursor C-Terminal Peptide

    For beta amyloid generation

    Amyloid Precursor C-Terminal Peptide  Chemical Structure
  29. GP10057 Amyloid β-Peptide (10-20) (human) Amyloid β-Peptide (10-20) (human)  Chemical Structure
  30. GP10094 Amyloid β-peptide (10-35), amide Amyloid β-peptide (10-35), amide  Chemical Structure
  31. GP10097 Amyloid β-Protein (1-15) Amyloid β-Protein (1-15)  Chemical Structure
  32. GC46851 Amyloid-β (1-42) Peptide (trifluoroacetate salt) A 42-amino acid protein fragment of amyloid-β Amyloid-β (1-42) Peptide (trifluoroacetate salt)  Chemical Structure
  33. GC42801 Amyloid-β (1-8) Peptide Amyloid-β (1-8) is a wild-type control for the mutation-containing amyloid-β (1-8, A2V) peptide . Amyloid-β (1-8) Peptide  Chemical Structure
  34. GC42802 Amyloid-β (1-8, A2V) Peptide Amyloid-β (1-8, A2V) is a truncated form of amyloid-β (Aβ) that contains a valine to alanine substitution at position 2 of the Aβ numbering convention (Aβ A2V), which corresponds to position 673 of the amyloid precursor protein (APP) numbering convention (APP A673V). Amyloid-β (1-8, A2V) Peptide  Chemical Structure
  35. GC42803 Amyloid-β (25-35) Peptide (human) (trifluoroacetate salt) Amyloid-β (25-35) (Aβ (25-35)) is an 11-residue fragment of the Aβ protein that retains the physical and biological characteristics of the full length peptide. Amyloid-β (25-35) Peptide (human) (trifluoroacetate salt)  Chemical Structure
  36. GC30866 Anabasine ((S)-Anabasine) 아나바신((S)-아나바신)((S)-아나바신((S)-아나바신))은 담배(니코티아나)에서 미량 성분으로 발견되는 알칼로이드입니다. Anabasine ((S)-Anabasine)  Chemical Structure
  37. GC39254 Anatabine dicitrate 아나타빈 구연산염은 혈뇌장벽을 통과할 수 있는 담배 알칼로이드입니다. Anatabine dicitrate  Chemical Structure
  38. GN10685 Anemarsaponin B Anemarsaponin B  Chemical Structure
  39. GC42809 Angiotensin II (3-8) (human, rat, mouse) (trifluoroacetate salt)

    Angiotensin II (3-8) is an endogenous C-terminal fragment of the peptide vasoconstrictor angiotensin II.

    Angiotensin II (3-8) (human, rat, mouse) (trifluoroacetate salt)  Chemical Structure
  40. GC46856 Angiotensin II (5-8) (human, rat, mouse) (trifluoroacetate salt)

    An endogenous angiotensin II fragment

    Angiotensin II (5-8) (human, rat, mouse) (trifluoroacetate salt)  Chemical Structure
  41. GC49419 Aniline-d5 An internal standard for the quantification of aniline Aniline-d5  Chemical Structure
  42. GC17695 Aniracetam 애니라세탐(Ro 13-5057)은 방향성 효과가 있는 경구 활성 신경 보호제입니다. Aniracetam  Chemical Structure
  43. GC14008 Anpirtoline hydrochloride 5-HT1B receptor agonist Anpirtoline hydrochloride  Chemical Structure
  44. GC31207 Ansofaxine hydrochloride (LY03005) 안소팍신 염산염(LY03005)(LY03005; LPM570065)은 삼중 재흡수 억제제입니다. 세로토닌, 도파민 및 노르에피네프린 재흡수를 각각 723, 491 및 763 nM의 IC50 값으로 억제합니다. Ansofaxine hydrochloride (LY03005)  Chemical Structure
  45. GC13899 Antazoline HCl Antazoline HCl은 1세대 항히스타민제로 항콜린성 특성을 가지고 있어 비강 충혈 및 점안액을 완화하는 데 사용됩니다. Antazoline HCl  Chemical Structure
  46. GC46858 Anthirine An alkaloid with analgesic activity Anthirine  Chemical Structure
  47. GC46859 Antide (acetate) A GnRHR antagonist Antide (acetate)  Chemical Structure
  48. GC31141 Antihistamine-1 항히스타민-1은 H1-항히스타민제(Ki=6.9 nM)로 혈액-뇌 장벽 침투가 허용되며 IC50이 각각 5.4 및 0.8 μM인 CYP2D6 및 hERG 채널의 억제제입니다. Antihistamine-1  Chemical Structure
  49. GC49209 Antisauvagine-30 (trifluoroacetate salt) A peptide CRF2 antagonist Antisauvagine-30 (trifluoroacetate salt)  Chemical Structure
  50. GC31134 AP521 AP521은 IC50이 94nM인 인간 5-HT1A 수용체의 작용제입니다. AP521  Chemical Structure
  51. GC30911 Apimostinel (NRX-1074) 아피모스티넬(NRX-1074)(NRX-1074; AGN-241660)은 경구 활성 NMDA 수용체 부분 작용제입니다. Apimostinel (NRX-1074)  Chemical Structure
  52. GC15200 Aprepitant Aprepitant(MK-0869)는 Kd가 86pM인 선택적 고친화성 뉴로키닌 1 수용체 길항제입니다. Aprepitant  Chemical Structure
  53. GC46868 Aprepitant-d4 An internal standard for the quantification of aprepitant Aprepitant-d4  Chemical Structure
  54. GC13340 AQ-RA 741 M2 antagonist,selective and high affinity AQ-RA 741  Chemical Structure
  55. GC31291 AR-A 2 (AR-A 000002) AR-A 2(AR-A 000002)는 선택적 5-HT1B 수용체 길항제로서 기니피그 피질 5HT1B/1D 및 재조합 기니피그 5-HT1B 수용체(Ki=0.24 및 0.47 nM)에 대해 높은 친화성을 갖고 10배 기니피그 5-HT1D 수용체(Ki, 5nM)에 대한 낮은 친화도, 기니피그 5-HT1B 수용체에 대해 4.5nM의 EC50을 나타냄; AR-A 2(AR-A 000002)는 우울증과 불안 연구에 사용할 수 있습니다. AR-A 2 (AR-A 000002)  Chemical Structure
  56. GC11060 AR-R 17779 hydrochloride AR-R 17779 염산염은 nAChR의 강력하고 선택적인 완전 작용제이며, Kis는 α7 및 α4β2 아형에 대해 각각 92 및 16000 nM입니다. AR-R 17779 hydrochloride  Chemical Structure
  57. GC49473 ARA 290 (acetate) A derivative of EPO ARA 290 (acetate)  Chemical Structure
  58. GC52514 Arachidonic Acid-d11 ethyl ester An internal standard for the quantification of arachidonic acid ethyl ester Arachidonic Acid-d11 ethyl ester  Chemical Structure
  59. GC46877 Arachidonoyl Glycine-d8 An internal standard for the quantification of arachidonoyl glycine Arachidonoyl Glycine-d8  Chemical Structure
  60. GC63654 Aramisulpride Aramisulpride는 대사 장애 연구에 사용되는 도파민 D2 수용체 및 세로토닌 수용체 길항제입니다. Aramisulpride  Chemical Structure
  61. GC35381 Arborine Arborine은 아세틸콜린의 말초 작용을 억제하여 혈압을 떨어뜨립니다. Arborine  Chemical Structure
  62. GC60596 Arecaidine 피리딘 알칼로이드인 아레카이딘은 강력한 GABA 흡수 억제제입니다. Arecaidine  Chemical Structure
  63. GC11415 Arecaidine but-2-ynyl ester tosylate mAChR M2 agonist Arecaidine but-2-ynyl ester tosylate  Chemical Structure
  64. GC63879 Arecaidine hydrochloride 피리딘 알칼로이드인 아레카이딘 염산염은 강력한 GABA 흡수 억제제입니다. Arecaidine hydrochloride  Chemical Structure
  65. GC16504 Arecaidine propargyl ester tosylate muscarinic receptor agonist Arecaidine propargyl ester tosylate  Chemical Structure
  66. GC13240 Arecoline Muscarinic acetylcholine receptors agonist Arecoline  Chemical Structure
  67. GC10264 Arecoline hydrobromide muscarinic acetylcholine receptor agonist Arecoline hydrobromide  Chemical Structure
  68. GC42852 Arginine Vasotocin (trifluoroacetate salt) Arginine vasotocin is a nonapeptide hormone agonist of the AVT receptor (EC50 = 13 nM for eliciting membrane currents in X. Arginine Vasotocin (trifluoroacetate salt)  Chemical Structure
  69. GC52332 Arimoclomol A co-inducer of heat shock proteins Arimoclomol  Chemical Structure
  70. GC10117 Aripiprazole 비정형 항정신병약물인 Aripiprazole(OPC-14597)은 강력하고 친화도가 높은 도파민 D2 수용체 부분 작용제입니다. Aripiprazole  Chemical Structure
  71. GC35386 Aripiprazole D8 Aripiprazole D8  Chemical Structure
  72. GC52168 Aripiprazole N,N-dioxide Aripiprazole N,N-dioxide  Chemical Structure
  73. GC52024 Aripiprazole N-oxide A metabolite of aripiprazole Aripiprazole N-oxide  Chemical Structure
  74. GC68687 Aripiprazole-d8

    Aripiprazole-d8는 아리피프라졸의 덴서 대체물입니다.

    Aripiprazole-d8  Chemical Structure
  75. GC11309 ARN2966 ARN2966은 APP 발현의 강력한 전사 후 조절제입니다. APP의 발현을 감소시켜 결과적으로 Aβ의 더 낮은 생산을 감소시킨다. ARN2966  Chemical Structure
  76. GC17525 AS 19 AS 19는 IC50 값이 0.83 nM이고 Ki가 0.6 nM인 강력한 선택적 5-HT7 수용체 작용제입니다. AS 19  Chemical Structure
  77. GC17776 Asaraldehyde COX-2 억제제인 Asarylaldehyde(Asaronaldehyde)는 100μg/mL의 IC50 값으로 cyclooxygenase II(COX-2) 활성을 유의하게 억제합니다. Asaraldehyde  Chemical Structure
  78. GC11824 Asenapine 비정형 항정신병제인 아세나핀(Org 5222)은 세로토닌 수용체(pKi: 8.4-10.5), 아드레날린 수용체(pKi: 8.9-9.5), 도파민 수용체(pKi: 8.9-9.4) 및 히스타민 수용체 8.2--의 길항제입니다. 9.0). Asenapine  Chemical Structure
  79. GC14518 Asenapine hydrochloride Asenapine hydrochloride  Chemical Structure
  80. GC63819 Asenapine maleate Asenapine maleate는 각각 Ki 값이 0.03-4.0nM, 1.3nM인 5-HT(1A, 1B, 2A, 2B, 2C, 5A, 6, 7) 및 D2 길항제이며 항정신병제입니다. Asenapine maleate  Chemical Structure
  81. GC15438 Asoxime (chloride) 아속심(염화물)(HI-6)은 니코틴 수용체, α7 nAChR을 포함한 아세틸콜린 수용체(AChR)에 대한 길항제입니다. Asoxime (chloride)  Chemical Structure
  82. GC40848 Aspalatone Aspalatone is an anti-platelet aggregator (IC50 = 180 μM, in vitro) that prolongs bleeding time significantly in a rodent model of thromboembolism. Aspalatone  Chemical Structure
  83. GC15706 Aspirin (Acetylsalicylic acid) A non-selective, irreversible COX inhibitor Aspirin (Acetylsalicylic acid)  Chemical Structure
  84. GC63683 Aspirin-d3 Aspirin-d3  Chemical Structure
  85. GC42859 Aspirin-d4 Aspirin-d4 is intended for use as an internal standard for the quantification of aspirin by GC- or LC-MS. Aspirin-d4  Chemical Structure
  86. GC16945 Astemizole 장기간 작용하여 알레르기 증상을 감소시키는 2세대 항히스타민제인 Astemizole(R 43512)은 IC50이 4nM인 히스타민 H1 수용체 길항제입니다. Astemizole  Chemical Structure
  87. GC16807 AT 1015 Long-acting 5-HT2A antagonist AT 1015  Chemical Structure
  88. GC31538 AT-1002 6-mer 합성 펩타이드인 AT-1002는 밀착 접합 조절제 및 흡수 증진제입니다. AT-1002  Chemical Structure
  89. GC34477 AT-1002 TFA

    AT-1002 TFA는 6개의 인공 펩타이드로, 촘촘한 접합 조절자 및 흡수 증진제입니다.

    AT-1002 TFA  Chemical Structure
  90. GC42865 AT-121 AT-121은 3.67 및 16.49 nM의 Kis를 갖는 이기능성 통각 및 뮤 오피오이드 수용체 작용제이다. AT-121  Chemical Structure
  91. GC39554 AT2 receptor agonist C21 AT2 수용체 작용제 C21은 AT2 수용체 및 AT1 수용체에 대해 각각 0.4 nM 및 >10 μM의 Ki 값을 갖는 약물 유사 선택적 안지오텐신 II AT2 수용체 작용제이다. AT2 receptor agonist C21  Chemical Structure
  92. GC18133 ATB-346 경구 활성 비스테로이드성 소염제(NSAID)인 ATB-346(ATB-346)은 사이클로옥시게나제-1 및 2(COX-1 및 2)를 억제합니다. ATB-346  Chemical Structure
  93. GC65596 Atogepant Atogepant(MK-8031)는 경구 활성 및 선택적 칼시토닌 유전자 관련 펩티드 수용체(CGRP) 길항제입니다. Atogepant  Chemical Structure
  94. GC38497 ATPA ATPA  Chemical Structure
  95. GC46891 ATPA (hydrate) An agonist of GluR5 ATPA (hydrate)  Chemical Structure
  96. GC15667 Atracurium Besylate Atracurium(BW-33A) 베실레이트는 강력하고 경쟁력 있는 비탈분극성 신경근 차단제입니다. Atracurium Besylate  Chemical Structure
  97. GC16526 Atropine

    MAChRs (Muscarinic Acetylcholine Receptors) 억제제

    Atropine  Chemical Structure
  98. GC35427 Atropine methyl bromide 무스카린 수용체(mAChR) 길항제인 아트로핀 메틸 브로마이드(Atropine methyl bromide)는 아트로핀의 4차 암모늄염이며 안과 검사 중 동공 확장을 위한 산동제입니다. Atropine methyl bromide  Chemical Structure
  99. GC35428 Atropine sulfate 아트로핀(트로핀 트로페이트) 황산염은 인간 mAChR M4 및 닭 mAChR M4에 대해 IC50 값이 각각 0.39 및 0.71nM인 경쟁적 무스카린성 아세틸콜린 수용체(mAChR) 길항제입니다. Atropine sulfate  Chemical Structure
  100. GC63827 Atropine sulfate monohydrate 아트로핀(트로핀 트로페이트) 황산염 일수화물은 항근시 효과가 있는 광범위하고 경쟁력 있는 무스카린성 아세틸콜린 수용체(mAChR) 길항제입니다. Atropine sulfate monohydrate  Chemical Structure
  101. GC46895 Aurintricarboxylic Acid (ammonium salt) A protein synthesis inhibitor with diverse biological activities Aurintricarboxylic Acid (ammonium salt)  Chemical Structure

Items 601 to 700 of 3533 total

페이지 당
  1. 5
  2. 6
  3. 7
  4. 8
  5. 9

내림차순