Resultados de búsqueda para: 'Peptide'

Categoría: Caspase Aminopeptidase ACE Cathepsin HCV Protease MMP Thrombin Other Proteases Endogenous Metabolite Mitochondrial Metabolism Pyroptosis Bax Bcl-2 Family TNF-α Other Apoptosis PD-1/PD-L1 interaction Histone Acetyltransferases Histone Demethylases Histone Methyltransferase Citrullination Histones/Histone Peptides Sterol Biosynthesis CYP3A/CYP450 Neuronal Metabolism P450 Bone Growth & Remodeling Carbohydrate Metabolism Cofactors & Vitamins Dyslipidemias Metabolic Syndrome Necrosis Nutrient Sensing Reproductive Biology PKA p38 JNK cAMP Broad Spectrum Protein Kinase Inhibitor EGFR Insulin Receptor Src Trk ATM/ATR CDK DNA/RNA Synthesis Casein Kinase AMPK GSK-3 S6 Kinase Antibiotic HCV HIV Antifungal Bacterial Parasite Coronaviruses Entry/Fusion Inhibitors COVID-19 Antiviral Microtubule/Tubulin Dynamin ECM & Adhesion Molecules Endomembrane System & Vesicular Trafficking Proteolysis Cytoskeleton & Motor Proteins Autophagy STAT PKC Integrin PAR1 Neuropeptide FF/AF Receptors Formyl Peptide Receptors 5-HT Receptor Adrenergic Receptor Apelin Receptor Angiotensin Receptor Bombesin Receptors Bradykinin Receptors Calcitonin and Related Receptors Cannabinoid Receptor CaSR CCR Chemokine Receptors Endothelin Receptor Galanin Receptors Ghrelin Receptors GIP Receptor Glucagon Receptor Melanocortin (MC) Receptors Motilin Receptor Non-selective CRF Neurotensin Receptors NOP Receptor NPY Receptors Oxytocin Receptors Peptide Receptors Protease-Activated Receptors Secretin Receptors Urotensin-II Receptor VIP Receptors Neuromedin U Receptors mAChR Neurokinin Receptor YAP AMPAR Calcium Channel Pannexin-1 TRP Channel Kainate Receptors Na+/K+ ATPase Cancer Biology Peptides Tumor Microenvironment Cell Migration & Metastasis GnRH Opioid Receptor Thyroid hormone Receptor TRH Glucocorticoids & Mineralocorticoids AChR Alzheimer Amyloid β CGRP DAPK Gap Junction GluR Histamine Receptor Neuroscience Peptides CaMK Behavioral Neuroscience Neuroendocrinology Neuroprotection Ophthalmology Pain Research Parkinson Seizure Disorders Prion Diabetes NAFLD & NASH Obesity Other Signal Transduction Apoptosis NF-κB Complement System IFNAR NOD-like Receptor (NLR) STING Reactive Oxygen Species Glutathione Adaptive Immunity Allergy Arthritis Autoimmunity Gastric Disease Innate Immunity Pulmonary Diseases PSMA Acute Phase Reactants Arrhythmia Atherosclerosis Chronic Kidney Disease Coagulation & Hemostasis Diabetic Nephropathy Endothelium Erythrocytes & Hemoglobin Heart Failure Hypertension Hypotension Myocardial Contractility Myocardial Hypertrophy Myocardial Infarction Serum Proteins Smooth Muscle Cells Stroke Thrombosis Vasoconstriction Vasodilation Antioxidants Carbohydrate Oxidation Lipid Peroxidation Pro-Oxidant Activity Adenylate cyclase Cell Penetrating Peptide Cytokine Enzyme Substrates / Activators Fluorescent Probes Glycoprotein Guanylate Cyclase MDR multidrug resistance Myosin Natriuretic Peptide Receptors Nitric Oxide Renin Tachykinin Transcription Factors Others Cyclase Negative Controls Toxicology Antiparasitics Toxins Peptide Coupling Reagents Amino Acids and Derivatives Fmoc-Amino Acids and Derivatives Other Resin and Derivatives Natural Products Cyanine Dyes Affinity Probes Dyes, Stains & Indicators Enzyme Substrates Fluorescence Biochemical Assay Reagents Tag Peptides Amyloid β protein Neuropeptides Peptide Hormones Inhibitors and Substrates Peptide Epitopes Peptides for Drug Delivery Click Chemistry reagents Dengue Yellow Fever Food-Borne Illnesses MRSA Pneumonia STDs Tuberculosis Candidiasis Leishmaniasis Quorum Sensing Macrophage Migration Inhibitory Factor Superoxide Dismutase

Cat.No. Nombre del producto Información
GC31523 Peptide YY (PYY) (3-36), human (Peptide YY (3-36)) El péptido YY (PYY) (3-36), humano (Péptido YY (3-36)) es un péptido de hormona intestinal que actÚa como agonista del receptor Y2 para reducir el apetito.
GC44598 Peptide YY (human) (trifluoroacetate salt)

Peptide Tyrosine Tyrosine
Peptide YY (human) (trifluoroacetate salt) is a peptide hormone secreted by intestinal L cells.
GC63855 Peptide YY (PYY) (3-36), porcine TFA El péptido YY (PYY) (3-36), TFA porcino, es un péptido de hormona intestinal que actÚa como agonista del receptor Y2 para reducir el apetito.
GC36874 Peptide YY (PYY) (3-36), human TFA
GC72259 Peptide A5K Peptide A5K (INF7-A5K-TAT) es un péptido de entrega de RNP que entrega CRISPR RNPs a las células T.
GC72139 Peptide5 TFA Peptide5 TFA, un péptido 43 mimético de conexina, reduce la hinchazón de los animales, astrogliosis, y muerte de la célula neuronal después de lesión de médula espinal.
GC32335 Peptide T TFA El péptido T (TFA) es un octapéptido de la regiÓn V2 de la gp120 del VIH-1.
GC32309 Peptide T El péptido T es un octapéptido de la regiÓn V2 de la gp120 del VIH-1.
GC31767 Peptide 401 El péptido 401, un potente factor de desgranulaciÓn de mastocitos del veneno de abeja, suprime el aumento de la permeabilidad vascular debido a la inyecciÓn intradérmica de varios espasmÓgenos del mÚsculo liso (histamina y 5-HT).
GC30452 Peptide YY (PYY), human

Peptide Tyrosine Tyrosine
El péptido YY (PYY) es una hormona intestinal que regula el apetito e inhibe la secreciÓn pancreÁtica.
GC36873 Peptide C105Y El péptido C105Y, un péptido sintético y de penetraciÓn celular basado en la secuencia de aminoÁcidos correspondiente a los residuos 359-374 de α1-antitripsina, mejora la expresiÓn génica a partir de nanopartÍculas de ADN.
GC52502 Peptide YY (3-36) (trifluoroacetate salt)

Pancreatic Peptide YY, Peptide Tyrosine Tyrosine
A satiety hormone
GA23355 Peptide Lv (rat) Peptide Lv has been discovered via a computational bioinformatics-based screening process. The neuropeptide is expressed in retinal photoreceptor layer, hippocampus, olfactory bulb, cerebellum, cerebral cortex, lung, spleen, liver and intestine. Peptide Lv enhances L-type voltage-gated calcium channel (L-VGCC) currents in retinal photoreceptors.
GC63347 Peptide 78 Péptido 78, una citocina quimiotÁctica, una proteÍna de 78 aminoÁcidos miembro de la familia de supergenes de quimiocinas IL-8 o C-X-C.
GC63141 Peptide 74 El péptido 74 es un péptido sintético que contiene la secuencia de prodominio de la metaloproteinasa de matriz (MMP). El péptido 74 inhibe la forma activada de la colagenasa tipo IV de 72 kDa in vitro.
GC30233 Peptide M El péptido M es un aminoÁcido sintético (18 aminoÁcidos de longitud que corresponden a las posiciones de aminoÁcidos 303-322 del antÍgeno S bovino: DTNLASSTIIKEGIDKTV), es capaz de inducir uveÍtis autoinmune experimental en monos y cobayas Hartley, asÍ como en ratas Lewis. .
GP10131 Peptide YY(3-36), PYY, human
GC50439 Peptide5 Peptide5, un péptido mimético de la conexina 43, reduce la inflamaciÓn de los animales, la astrogliosis y la muerte de las células neuronales después de una lesiÓn de la médula espinalIn vitro: Peptide5, reduce significativamente el grado de lesiÓn de la médula espinal (SCI) en un modelo ex vivo de roedores.
GA23356 Peptide WE-14 WE-14, a chromogranin A-derived peptide, was isolated from a human ileal carcinoid tumor. Its sequence WSKMDQLAKELTAE is highly conserved in many mammalian species and flanked by typical processing sites. Such factors would indicate a potential physiological role for peptide WE-14.
GA23357 Peptide YY (13-36) (canine, mouse, porcine, rat) This C-terminal fragment was shown to suppress the noradrenaline release from sympathetic nerve endings. It thereby mimics the effects of PYY and NPY at presynaptic (Y?) receptors. The peptide was also able to compete with NPY for essentially all binding sites in rat brain.
GA23358 Peptide YY (canine, mouse, porcine, rat)
GC30535 Transdermal Peptide (TD 1 (peptide)) Transdermal Peptide (TD 1 (peptide)), que consiste en 11 aminoácidos, es el primer péptido potenciador transdérmico descubierto mediante la técnica de phage display.
GC31527 C-Peptide, dog (C-Peptide (dog))

C-Peptide (dog)
C-Peptide, dog (Péptido C (perro)) es un componente de la proinsulina, liberado de las células beta pancreÁticas en la sangre junto con la insulina.
GC31172 δ-Sleep Inducing Peptide (Delta-Sleep Inducing Peptide) δ-Péptido Inductor del SueÑo (Delta-Sleep Inducing Peptide) es un neuropéptido, con propiedades antioxidantes y ansiolÍticas.
GP10154 Hexa His tag peptide

H-His-His-His-His-His-His-OH
The Hexa His tag peptide is a short peptide composed of six consecutive histidine residues and also serves as a purification tag for fusion proteins. The Hexa His tag peptide can chelate with metal ions such as nickel and cobalt. Recombinant proteins can be efficiently purified by immobilized metal ion affinity chromatography.
GC34397 Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) El péptido sintético Sphistin (12-38, Fitc en el péptido marcado con fluorescencia N-terminal) es un fragmento truncado del péptido sintético Sphistin que muestra una potente actividad antimicrobiana.
GP10149 3X FLAG Peptide

H-Met-Asp-Tyr-Lys-Asp-His-Asp-Gly-Asp-Tyr-Lys-Asp-His-Asp-Ile-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-OH
3X FLAG Peptide es un polipéptido sintético que contiene tres secuencias repetidas de aminoácidos DYKXXD,que a menudo se utiliza para unirse de forma competitiva a los anticuerpos anti.Flag.
GC78408 SRC-1 NR box peptide acetate SRC-1 NR box peptide acetate is a biological active peptide (This peptide is a 14-amino acid fragment from the steroid receptor cofactor SRC-1 NR II).
GC78724 Osteoblast-Adhesive Peptide acetate Osteoblast-Adhesive Peptide (Lys-Arg-Ser-Arg) acetate is an adhesion peptide that can be used as a dental/orthopedic biomaterial to support and enhance osteoblast (anchorage-dependent cell) adhesion.
GC77680 Multi-Leu peptide triacetate

ML-peptide, Multi-Leucine (ML)-peptide triacetate
Multi-Leu peptide (ML-peptide) triacetate is a potent inhibitor ofPACE4(Ki=22 nM).
GC77742 R5 peptide acetate R5 peptide acetate shows silica-precipitating activity.
GP10150 FLAG tag Peptide

H-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-OH
FLAG tag Peptide es un péptido de 8 aminoácidos (Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys) que contiene un sitio de restricción de la quinasa intestinal.
GC30285 Eledoisin (Eledone peptide)

ELD 950, Moschatin
A neurokinin receptor agonist
GC16385 RGDS peptide

Fibronectin Inhibitor, HArgGlyAspSerOH
El péptido RGDS es una secuencia de uniÓn a integrina que inhibe la funciÓn del receptor de integrina.
GP10155 S Tag Peptide
S Tag es el nombre de un oligopéptido derivado de la ribonucleasa A pancreática (RNasa A).
GC52376 BMP2-derived Peptide (trifluoroacetate salt)

Bone Morphogenic Protein 2-derived Peptide, KIPKASSVPTELSAISTLYL-NH2
A synthetic peptide
GC44655 PKCε Inhibitor Peptide

Protein Kinase Cɛ Inhibitor Peptide，ɛV1-2
PKCε Inhibitor Peptide, también llamado εV1-2, es un péptido derivado de la proteína quinasa C ε (PKCε), actúa como un inhibidor selectivo de PKCε e inhibe la translocación de PKCε.
GC78564 MPSD control peptide TFA

MARCKS-ED control peptide TFA
MPSDcontrol peptide (MARCKS-ED control peptide) TFA is the control peptide ofMPSD.
GC92223 PR 39 Peptide (porcine) (trifluoroacetate salt)

Antibacterial Protein PR 39 (131-169); Proline-arginine-rich 39 peptide (131-169)
Proline-arginine-rich 39 peptide (PR 39 peptide) is an antibacterial peptide.
GC45382 Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt)

Aβ (1-28), Aβ28
GC78436 Biotin-Gastrin Releasing Peptide, human TFA Biotin-Gastrin Releasing Peptide, human TFA is a biotinylatedgastrinreleasing peptide (GRP).
GC77720 CREKA peptide acetate CREKA peptide acetate is a short peptide sequence, belonging to self-assembling peptides (SAPs), which can self-assemble into functional nanostructures, typically nanofibers, under physiological conditions.
GC77690 Targeting the bacterial sliding clamp peptide 46 TFA Targeting thebacterialsliding clamp peptide 46 TFA is a short peptide targeting thebacterialsliding clamp(SC), inhibiting SC-dependent DNA synthesis.
GC92231 Tat 2-4 Peptide (trifluoroacetate salt)

Transactivator of Transcription Peptide (2-4)
Tat 2-4 Peptide is a peptide derived from HIV-1 transactivator of transcription (Tat) protein.
GC91860 Glucose-dependent Insulinotropic Peptide (22-51) (human) (trifluoroacetate salt)

GIP (22-51),Gastric Inhibitory Peptide (22-51)
Glucose-dependent insulinotropic peptide (GIP) (22-51) is a pro-atherogenic 30-amino acid peptide corresponding to residues 22-51 of the GIP precursor protein proGIP that has been found in human plasma.
GC91854 RS Repeat Peptide (trifluoroacetate salt) RS repeat peptide is a serine/arginine-rich peptide substrate for CDC-like kinase 1 (Clk1).
GC91847 KEMPFPKYPVEP Peptide (bovine, ovine) (trifluoroacetate salt) KEMPFPKYPVEP Peptide is a peptide fragment of the dairy protein β-casein.
GC91835 Heparin-binding Peptide (trifluoroacetate salt)

Fibronectin Adhesion-promoting Peptide,Fibronectin Peptide V,FN-C/H-V
Heparin-binding peptide is a synthetic peptide fragment corresponding to residues 1,892-1,899 of the C-terminal heparin-binding domain of fibronectin.
GP10091 Vasonatrin Peptide (1-27)

H2N-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH
Vasonatrin Peptide (1-27), (C124H198N36O36S3), a peptide with the sequence H2N-GLSKGCFGLKLDRIGSMSGLGCNSFRY-OH, MW= 2865.4.
GP10082 Amyloid Beta-peptide (25-35) (human) Amyloid Beta-peptide (25-35) (human) es un fragmento de Alzheimer's Amyloid beta peptide que se encuentra comúnmente en el cerebro de las personas con enfermedad de Alzheimer(EA) y es un componente importante de las placas amiloides de Alzheimer.
GC52385 Myelin Basic Protein (85-99) Peptide Antagonist (trifluoroacetate salt)

EKPKVEAYKAAAAPA-OH, MBP (85-99) Peptide Antagonist
An MBP (85-99) antagonist
GC66061 Competence-Stimulating Peptide-2 (CSP-2) El péptido estimulante de la competencia-2 (CSP-2) es un péptido seÑal de detecciÓn de quÓrum producido por Streptococcus pneumoniae. ComD2 es un receptor compatible del péptido estimulante de la competencia 2 (CSP-2) con un valor EC50 de 50,7 nM.
GC35432 Autocamtide-2-related inhibitory peptide (TFA)
GC78623 Link N peptide Link N peptide is aproteoglycan aggregatesactivator in the extracellular matrix.
GC78569 PADRE peptide PADRE peptide is a universal peptidic epitope.
GC92117 RVG Peptide (trifluoroacetate salt)

Rabies Virus Glycoprotein; Rabies Virus Glycoprotein 29; RABV-G; RVG29
RVG Peptide (trifluoroacetate salt) es un antagonista del receptor nicotínico acetilcolina (nAChR) (IC50 = 2,5 μM para el receptor humano).
GC74301 FLAG peptide TFA FLAG peptide TFA es la forma de sal TFA del péptido bandera.
GC91844 [pGlu4]-Myelin Basic Protein Peptide (trifluoroacetate salt)

pGlu4-MBP Peptide
[pGlu]-Myelin basic protein peptide is a substrate for PKC.
GP10049 Amyloid Beta-Peptide (12-28) (human) Amyloid Beta-Peptide (12-28) (human) es un fragmento peptídico de la proteína beta amiloide (1-42) (Aβ (1-42)).
GP10152 Influenza Hemagglutinin (HA) Peptide

H-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-OH

Un péptido
GC52361 AMARA Peptide (trifluoroacetate salt)

AMARAASAAALARRR-OH, H-Ala-Met-Ala-Arg-Ala-Ala-Ser-Ala-Ala-Ala-Leu-Ala-Arg-Arg-Arg-OH
A peptide substrate for AMPK
GC52196 RGD Peptide

GRGDNP, HGlyArgGlyAspAsnProOH
El péptido RGD actÚa como un inhibidor de las interacciones integrina-ligando y juega un papel importante en la adhesiÓn, migraciÓn, crecimiento y diferenciaciÓn celular.
GC49883 DAPK Substrate Peptide (trifluoroacetate salt)

Death-associated Protein Kinase Substrate Peptide
A DAPK1 peptide substrate
GC48346 DYKDDDDK Peptide (trifluoroacetate salt)

DYKDDDDK Epitope, DYKDDDDK Octapeptide, DYKDDDDK Tag
GC37524 RGD peptide (GRGDNP) TFA
GC35123 3X FLAG peptide TFA
GC44806 Ras Inhibitory Peptide

Sos SH3 Domain Inhibitor
Son of sevenless homolog 1 (Sos1) is a guanine nucleotide exchange factor (GEF) that directs the exchange of Ras-GDP to Ras-GTP by binding to SH3 domains of the growth factor receptor-bound protein 2 (Grb2), leading to the activation of ERK.
GC34274 SPACE peptide El péptido SPACE es un péptido que penetra en la piel (SPP).
GC32787 iRGD peptide (c(CRGDKGPDC))

c(CRGDKGPDC)
El péptido iRGD (c(CRGDKGPDC)) es un péptido cÍclico de 9 aminoÁcidos, desencadena la penetraciÓn de los fÁrmacos en los tejidos al unirse primero a las integrinas av, luego se escinde proteolÍticamente en el tumor para producir CRGDK/R para interactuar con la neuropilina-1, y tiene -Propiedades dirigidas y penetrantes de tumores.
GC91470 Fyn Peptide (410-430) (human, mouse, rat, porcine, bovine) (trifluoroacetate salt)

Src (409-429) (human, rat); Src (408-428) (mouse)

El péptido Fyn (410-430) es un fragmento de péptido de la quinasa tirosina no receptora de la familia Src, llamada Fyn, que contiene Tyr420, el cual se somete a autofosforilación al activarse la forma completa de Fyn.
GC91462 Abl Substrate Peptide (trifluoroacetate salt)
El péptido sustrato Abl es un sustrato de péptido para la tirosina quinasa Abl.
GC91441 RGD Peptide (trifluoroacetate salt)

GRGDNP; H-Gly-Arg-Gly-Asp-Asn-Pro-OH

El péptido RGD es un compuesto sintético compuesto por el motivo arginina-glicina-aspartato que se ha utilizado ampliamente para inhibir las interacciones integrina-ligando en estudios relacionados con la adhesión celular, migración, crecimiento y diferenciación.
GC91027 EGFRvIII Peptide (trifluoroacetate salt)
Un fragmento de péptido EGFRvIII
GC90733 Klotho-derived Peptide 1 (56-87) (human) (trifluoroacetate salt)
Un péptido disruptor de TGF-β
GC90635 RAD17-derived Peptide (trifluoroacetate salt)
Un sustrato de péptido para ATR
GC90620 N-Peptide (trifluoroacetate salt)
Un péptido
GC90600 Tat-NTS Peptide (trifluoroacetate salt)
Un péptido de penetración celular
GC90561 Gastric Inhibitory Peptide (22-51) (human) (trifluoroacetate salt)
Un péptido proaterogénico.
GC90558 Myelin Basic Protein Peptide Antagonist (trifluoroacetate salt)
Un antagonista de MBP
GC90547 Gastric Inhibitory Peptide 1 (3-42) (human) (trifluoroacetate salt)
Un fragmento de péptido de GIP y un antagonista del receptor de GIP.
GC90546 MOG Peptide (human, bovine) (acetate)
Un péptido de vaina de mielina endógeno.
GC90543 EGFR Peptide (human, mouse) (myristoylated) (trifluoroacetate salt)
Un inhibidor de PKC
GC90542 EGFR Peptide (human, mouse) (trifluoroacetate salt)
Un sustrato péptido de PKC
GC90534 Gastric Inhibitory Peptide (1-39) (porcine) (trifluoroacetate salt)
Un inductor de secreción de insulina.
GC90529 Myelin Basic Protein Peptide (mouse, bovine) (trifluoroacetate salt)
Un sustrato péptido para PKC
GC90286 Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt)
Un fragmento de proteína amiloide-β de 28 residuos
GC70187 δ-Sleep Inducing Peptide acetate

Delta-Sleep Inducing Peptide acetate

El acetato de péptido inductor del sueño δ es un neuropéptido que tiene propiedades antioxidantes y anti-ansiedad.
GC17195 Bax inhibitor peptide V5

BIP-V5; BAX Inhibiting Peptide V5
A Bax inhibitor
GP10104 S6 Kinase Substrate Peptide 32

H2N-Lys-Glu-Ala-Lys-Glu-Lys-Arg-Gln-Glu-Gln-Ile-Ala-Lys-Arg-Arg-Arg-Leu-Ser-Ser-Leu-Arg-Ala-Ser-Thr-Ser-Lys-Ser-Gly-Gly-Ser-Gln-Lys-OH
Measures the activity of kinases that phosphorylate ribosomal protein S6.
GP10108 EGF-R (661-681) T669 Peptide

H2N-Lys-Arg-Glu-Leu-Val-Glu-Pro-Leu-Thr-Pro-Ser-Gly-Glu-Ala-Pro-Asn-Gln-Ala-Leu-Leu-Arg-OH
GP10011 Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell

Ac-Pro-Tyr-Asn-Ser-Ser-Pro-Arg-Pro-Glu-Gln-His-Lys-Ser-Tyr-Lys-Cys-OH
GP10098 Cdk2/Cyclin Inhibitory Peptide I

H2N-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Pro-Val-Lys-Arg-Arg-Leu-Phe-Gly-OH
GP10094 Amyloid β-peptide (10-35), amide

H2N-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-NH2
GP10147 Ribosomal protein L3 peptide (202-222) amide

H2N-Met-Ser-His-Arg-Lys-Tyr-Glu-Ala-Pro-Arg-His-Gly-His-Leu-Gly-Phe-Leu-Pro-Arg-Lys-Arg-amide
GP10042 Rhodopsin peptide

H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH
GP10127 Cadherin Peptide, avian

H2N-Leu-Arg-Ala-His-Ala-Val-Asp-Val-Asn-Gly-amide

Role in cell adhesion
GP10095 Epidermal Growth Factor Receptor Peptide (985-996)

H2N-Asp-Val-Val-Asp-Ala-Asp-Glu-Tyr-Leu-Ile-Pro-Gln-OH
GP10089 Platelet Membrane Glycoprotein IIB Peptide (296-306)

H2N-Thr-Asp-Val-Asn-Gly-Asp-Gly-Arg-His-Asp-Leu-OH

Inhibits platelet aggregation
GP10046 Amyloid Precursor C-Terminal Peptide

H2N-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH

For beta amyloid generation
GP10118 Amyloid Beta-Peptide (1-40) (human)
Péptido beta-amiloide (1-40) (humano), (C194H295N53O58S1), un péptido con la secuencia H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. El beta-amiloide (Aβ o Abeta) es un péptido de 36 a 43 aminoácidos que se procesa a partir de la proteína precursora del amiloide.

Products for Categoría