Search Site
  • 0
    My Cart

    Click Here to Find How Many Items You Have Added:)

    image loader

    Adding item(s) to cart......

Home >> Signaling Pathways >> Neuroscience

Neuroscience

Neuroscience

Neuroscience

Neurons communicate with each other, effector organs and sensory organs through the neurotransmitter – receptor pathway at synapses. Neurotransmitters can be divided into 4 major groups: 1. Amino acids (glumate, aspartate, serine, glycine and GABA); 2. Monoamines (norepinephrine, epinephrine, dopamine, histamine, and serotonin); 3. Peptides (opioid peptides, substance P, somatostatin); and 4. Others (acetylcholine, NO, nucleosides).

Targets for  Neuroscience

Products for  Neuroscience

  1. Cat.No. Product Name Information
  2. GC34064 Aminooxyacetic acid hemihydrochloride (Carboxymethoxylamine Hemihydrochloride) Aminooxyacetic acid (Carboxymethoxylamine) hemihydrochloride is a malate-aspartate shuttle (MAS) inhibitor which also inhibits the GABA degradating enzyme GABA-T. Aminooxyacetic acid hemihydrochloride (Carboxymethoxylamine Hemihydrochloride) Chemical Structure
  3. GC16052 Aminopotentidine H2 antagonist Aminopotentidine Chemical Structure
  4. GC12610 Amisulpride Dopamine D2/D3 receptor antagonist Amisulpride Chemical Structure
  5. GC35323 Amisulpride hydrochloride Amisulpride hydrochloride is a dopamine D2/D3 receptor antagonist with Kis of 2.8 and 3.2 nM for human dopamine D2 and D3, respectively. Amisulpride hydrochloride Chemical Structure
  6. GC52004 Amisulpride N-oxide A degradation product of amisulpride Amisulpride N-oxide Chemical Structure
  7. GC46843 Amisulpride-d5 An internal standard for the quantification of amisulpride Amisulpride-d5 Chemical Structure
  8. GC30981 Amitifadine hydrochloride (DOV-21947 hydrochloride) Amitifadine hydrochloride (DOV-21947 hydrochloride) is a serotonin-norepinephrine-dopamine reuptake inhibitor (SNDRI), with IC50s of 12, 23, 96 nM for serotonin, norepinephrine and dopamine in HEK 293 cells , respectively. Amitifadine hydrochloride (DOV-21947 hydrochloride) Chemical Structure
  9. GC33983 Amitraz (BTS-27419) Amitraz (BTS-27419) is a non-systemic acaricide and insecticide, with alpha-adrenergic agonist activity, interaction with octopamine receptors of the central nervous system and inhibition of monoamine oxidases and prostaglandin synthesis. Amitraz (BTS-27419) Chemical Structure
  10. GC25060 Amitriptyline Amitriptyline (MK-230, N-750, Ro41575) is a tricyclic antidepressant (TCA) with analgesic properties, widely used to treat depression and neuropathic pain. Amitriptyline is an inhibitor of both serotonin transporter (SERT) and norepinephrine transporter (NET) with Ki of 3.45 nM and 13.3 nM, respectively. Amitriptyline also inhibits histamine receptor H1, histamine receptor H4, 5-HT2 and sigma 1 receptor with Ki of 0.5 nM, 7.31 nM, 235 nM and 287 nM, respectively. This product is a waxy solid. Amitriptyline Chemical Structure
  11. GC13723 Amitriptyline HCl Amitriptyline HCl is an inhibitor of serotonin reuptake transporter (SERT) and noradrenaline reuptake transporter (NET), with Kis of 3.45 nM and 13.3 nM for human SERT and NET, respectively. Amitriptyline HCl Chemical Structure
  12. GC49336 AMK (hydrochloride) An active metabolite of melatonin AMK (hydrochloride) Chemical Structure
  13. GC11287 AMN 082 dihydrochloride AMN 082 dihydrochloride, a selective, orally active, and brain penetrant mGluR7 agonist, directly activates receptor signaling via an allosteric site in the transmembrane domain. AMN 082 dihydrochloride Chemical Structure
  14. GC68438 AMPA receptor modulator-3 AMPA receptor modulator-3 Chemical Structure
  15. GC14104 Ampiroxicam COX inhibitor Ampiroxicam Chemical Structure
  16. GC33484 Ampyrone (4-Aminoantipyrine) Ampyrone (4-Aminoantipyrine) Chemical Structure
  17. GC12472 Amthamine dihydrobromide H2 agonist Amthamine dihydrobromide Chemical Structure
  18. GC42796 Amylin (human) (trifluoroacetate salt) Amylin is a 37-residue peptide hormone secreted from pancreatic β-cells that reduces food intake, decreases glucagon secretion, slows gastric emptying, and increases satiety. Amylin (human) (trifluoroacetate salt) Chemical Structure
  19. GC35334 Amyloid β Peptide (42-1)(human) Amyloid β Peptide (42-1)(human) is the inactive form of Amyloid β Peptide (1-42). Amyloid β Peptide (42-1)(human) Chemical Structure
  20. GA20733 Amyloid β-Protein (1-42)

    Compared to the inner salt, the HCl salt of Aβ42 aggregates more readily at pH 7.4.

     Amyloid β-Protein (1-42) Chemical Structure
  21. GA20730 Amyloid β-Protein (1-42) (HFIP-treated) H-7442 was obtained by dissolving Amyloid β-Protein (1-42) (H-1368) in HFIP, aliquoting, and removing the solvent as described in the literature. Amyloid β-Protein (1-42) (HFIP-treated) Chemical Structure
  22. GA20736 Amyloid β-Protein (1-43) Amyloid β-Protein (1-43) is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. Amyloid β-Protein (1-43) Chemical Structure
  23. GP10099 amyloid A protein fragment [Homo sapiens] Apolipoproteins related to HDL in plasma amyloid A protein fragment [Homo sapiens] Chemical Structure
  24. GP10118 Amyloid Beta-Peptide (1-40) (human)

    Amyloid β-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (Aβ or Abeta) is a peptide of 36–43 amino acids that is processed from the Amyloid precursor protein.

     Amyloid Beta-Peptide (1-40) (human) Chemical Structure
  25. GP10049 Amyloid Beta-Peptide (12-28) (human)

    Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)).

     Amyloid Beta-Peptide (12-28) (human) Chemical Structure
  26. GP10082 Amyloid Beta-peptide (25-35) (human)

    Amyloid beta-peptide (25-35) (human) is an fragment of Alzheimer's Amyloid beta peptide which has neurotoxic effects.

     Amyloid Beta-peptide (25-35) (human) Chemical Structure
  27. GC33160 amyloid P-IN-1 amyloid P-IN-1 is used in the research of diseases or disorders wherein depletion of serum amyloid P component (SAP), including amyloidosis, Alzheimer's disease, type 2 diabetes mellitus and osteoarthritis. amyloid P-IN-1 Chemical Structure
  28. GP10046 Amyloid Precursor C-Terminal Peptide

    For beta amyloid generation

     Amyloid Precursor C-Terminal Peptide Chemical Structure
  29. GP10057 Amyloid β-Peptide (10-20) (human) Amyloid β-Peptide (10-20) (human) Chemical Structure
  30. GP10094 Amyloid β-peptide (10-35), amide Amyloid β-peptide (10-35), amide Chemical Structure
  31. GP10097 Amyloid β-Protein (1-15) Amyloid β-Protein (1-15) Chemical Structure
  32. GC46851 Amyloid-β (1-42) Peptide (trifluoroacetate salt) A 42-amino acid protein fragment of amyloid-β Amyloid-β (1-42) Peptide (trifluoroacetate salt) Chemical Structure
  33. GC42801 Amyloid-β (1-8) Peptide Amyloid-β (1-8) is a wild-type control for the mutation-containing amyloid-β (1-8, A2V) peptide . Amyloid-β (1-8) Peptide Chemical Structure
  34. GC42802 Amyloid-β (1-8, A2V) Peptide Amyloid-β (1-8, A2V) is a truncated form of amyloid-β (Aβ) that contains a valine to alanine substitution at position 2 of the Aβ numbering convention (Aβ A2V), which corresponds to position 673 of the amyloid precursor protein (APP) numbering convention (APP A673V). Amyloid-β (1-8, A2V) Peptide Chemical Structure
  35. GC42803 Amyloid-β (25-35) Peptide (human) (trifluoroacetate salt) Amyloid-β (25-35) (Aβ (25-35)) is an 11-residue fragment of the Aβ protein that retains the physical and biological characteristics of the full length peptide. Amyloid-β (25-35) Peptide (human) (trifluoroacetate salt) Chemical Structure
  36. GC30866 Anabasine ((S)-Anabasine) Anabasine ((S)-Anabasine) ((S)-Anabasine ((S)-Anabasine)) is an alkaloid that found as a minor component in tobacco (Nicotiana). Anabasine ((S)-Anabasine) Chemical Structure
  37. GC39254 Anatabine dicitrate Anatabine dicitrate is a tobacco alkaloid that can cross the blood-brain barrier. Anatabine dicitrate Chemical Structure
  38. GN10685 Anemarsaponin B Anemarsaponin B Chemical Structure
  39. GC42809 Angiotensin II (3-8) (human, rat, mouse) (trifluoroacetate salt)

    Angiotensin II (3-8) is an endogenous C-terminal fragment of the peptide vasoconstrictor angiotensin II.

     Angiotensin II (3-8) (human, rat, mouse) (trifluoroacetate salt) Chemical Structure
  40. GC46856 Angiotensin II (5-8) (human, rat, mouse) (trifluoroacetate salt)

    An endogenous angiotensin II fragment

     Angiotensin II (5-8) (human, rat, mouse) (trifluoroacetate salt) Chemical Structure
  41. GC49419 Aniline-d5 An internal standard for the quantification of aniline Aniline-d5 Chemical Structure
  42. GC17695 Aniracetam Nootropic drug for senile dementia Aniracetam Chemical Structure
  43. GC14008 Anpirtoline hydrochloride 5-HT1B receptor agonist Anpirtoline hydrochloride Chemical Structure
  44. GC31207 Ansofaxine hydrochloride (LY03005) Ansofaxine hydrochloride (LY03005) (LY03005; LPM570065) is a triple reuptake inhibitor; inhibits serotonin, dopamine and norepinephrine reuptake with IC50 values of 723, 491 and 763 nM, respectively. Ansofaxine hydrochloride (LY03005) Chemical Structure
  45. GC13899 Antazoline HCl Antazoline HCl is a 1st generation antihistamine with also anticholinergic properties used to relieve nasal congestion and in eye drops. Antazoline HCl Chemical Structure
  46. GC46858 Anthirine An alkaloid with analgesic activity Anthirine Chemical Structure
  47. GC46859 Antide (acetate) A GnRHR antagonist Antide (acetate) Chemical Structure
  48. GC31141 Antihistamine-1 Antihistamine-1 is a H1-antihistamine (Ki=6.9 nM) with acceptable blood-brain barrier penetration and also an inhibitor of CYP2D6 and hERG channel with IC50s of 5.4 and 0.8 μM, respectively. Antihistamine-1 Chemical Structure
  49. GC49209 Antisauvagine-30 (trifluoroacetate salt) A peptide CRF2 antagonist Antisauvagine-30 (trifluoroacetate salt) Chemical Structure
  50. GC31134 AP521 AP521 is an agonist of human 5-HT1A receptor with an IC50 of 94 nM. AP521 Chemical Structure
  51. GC30911 Apimostinel (NRX-1074) Apimostinel (NRX-1074) (NRX-1074; AGN-241660) is an orally active NMDA receptor partial agonist. Apimostinel (NRX-1074) Chemical Structure
  52. GC15200 Aprepitant Substance P (SP) inhibitor Aprepitant Chemical Structure
  53. GC46868 Aprepitant-d4 An internal standard for the quantification of aprepitant Aprepitant-d4 Chemical Structure
  54. GC13340 AQ-RA 741 M2 antagonist,selective and high affinity AQ-RA 741 Chemical Structure
  55. GC31291 AR-A 2 (AR-A 000002) AR-A 2 (AR-A 000002) is a selective 5-HT1B receptor antagonist, with high affinity to guinea pig cortex 5HT1B/1D and recombinant guinea pig 5-HT1B receptors (Ki=0.24 and 0.47 nM) and with 10-fold lower affinity to guinea pig 5-HT1D receptor (Ki, 5 nM), and shows an EC50 of 4.5 nM for the guinea pig 5-HT1B receptor; AR-A 2 (AR-A 000002) can be used in the research of depression and anxiety. AR-A 2 (AR-A 000002) Chemical Structure
  56. GC11060 AR-R 17779 hydrochloride Selective agonist of α7 nAChRs AR-R 17779 hydrochloride Chemical Structure
  57. GC49473 ARA 290 (acetate) A derivative of EPO ARA 290 (acetate) Chemical Structure
  58. GC52514 Arachidonic Acid-d11 ethyl ester An internal standard for the quantification of arachidonic acid ethyl ester Arachidonic Acid-d11 ethyl ester Chemical Structure
  59. GC46877 Arachidonoyl Glycine-d8 An internal standard for the quantification of arachidonoyl glycine Arachidonoyl Glycine-d8 Chemical Structure
  60. GC63654 Aramisulpride Aramisulpride is a dopamine D2 receptor and serotonin receptor antagonist used for the research of metabolic disorders. Aramisulpride Chemical Structure
  61. GC35381 Arborine Arborine inhibits the peripheral action of acetylcholine and induces a fall in blood pressure. Arborine Chemical Structure
  62. GC60596 Arecaidine Arecaidine, a pyridine alkaloid, is a potent GABA uptake inhibitor. Arecaidine Chemical Structure
  63. GC11415 Arecaidine but-2-ynyl ester tosylate mAChR M2 agonist Arecaidine but-2-ynyl ester tosylate Chemical Structure
  64. GC63879 Arecaidine hydrochloride Arecaidine hydrochloride, a pyridine alkaloid, is a potent GABA uptake inhibitor. Arecaidine hydrochloride Chemical Structure
  65. GC16504 Arecaidine propargyl ester tosylate muscarinic receptor agonist Arecaidine propargyl ester tosylate Chemical Structure
  66. GC13240 Arecoline Muscarinic acetylcholine receptors agonist Arecoline Chemical Structure
  67. GC10264 Arecoline hydrobromide muscarinic acetylcholine receptor agonist Arecoline hydrobromide Chemical Structure
  68. GC42852 Arginine Vasotocin (trifluoroacetate salt) Arginine vasotocin is a nonapeptide hormone agonist of the AVT receptor (EC50 = 13 nM for eliciting membrane currents in X. Arginine Vasotocin (trifluoroacetate salt) Chemical Structure
  69. GC52332 Arimoclomol A co-inducer of heat shock proteins Arimoclomol Chemical Structure
  70. GC10117 Aripiprazole 5-HT receptor partial agonist Aripiprazole Chemical Structure
  71. GC35386 Aripiprazole D8 Aripiprazole D8 Chemical Structure
  72. GC52168 Aripiprazole N,N-dioxide Aripiprazole N,N-dioxide Chemical Structure
  73. GC52024 Aripiprazole N-oxide A metabolite of aripiprazole Aripiprazole N-oxide Chemical Structure
  74. GC68687 Aripiprazole-d8

    Aripiprazole-d8 is the deuterated form of Aripiprazole.

     Aripiprazole-d8 Chemical Structure
  75. GC11309 ARN2966

    APP expression modulator

     ARN2966 Chemical Structure
  76. GC17525 AS 19 Potent 5-HT7 agonist AS 19 Chemical Structure
  77. GC17776 Asaraldehyde COX inhibitor Asaraldehyde Chemical Structure
  78. GC11824 Asenapine Inhibits adrenergic receptor/5-HT receptor Asenapine Chemical Structure
  79. GC14518 Asenapine hydrochloride Asenapine hydrochloride Chemical Structure
  80. GC63819 Asenapine maleate Asenapine maleate is a 5-HT (1A, 1B, 2A, 2B, 2C, 5A, 6, 7) and D2 antagonist with Ki values of 0.03-4.0 nM, 1.3nM, respectively, and an antipsychotic. Asenapine maleate Chemical Structure
  81. GC15438 Asoxime (chloride) Asoxime (chloride) (HI-6) is an antagonist to acetylcholine receptors (AChRs) including the nicotinic receptor, α7 nAChR. Asoxime (chloride) Chemical Structure
  82. GC40848 Aspalatone Aspalatone is an anti-platelet aggregator (IC50 = 180 μM, in vitro) that prolongs bleeding time significantly in a rodent model of thromboembolism. Aspalatone Chemical Structure
  83. GC15706 Aspirin (Acetylsalicylic acid) A non-selective, irreversible COX inhibitor Aspirin (Acetylsalicylic acid) Chemical Structure
  84. GC63683 Aspirin-d3 Aspirin-d3 Chemical Structure
  85. GC42859 Aspirin-d4 Aspirin-d4 is intended for use as an internal standard for the quantification of aspirin by GC- or LC-MS. Aspirin-d4 Chemical Structure
  86. GC16945 Astemizole anti-histamine compound, potent Astemizole Chemical Structure
  87. GC16807 AT 1015 Long-acting 5-HT2A antagonist AT 1015 Chemical Structure
  88. GC31538 AT-1002

    AT-1002, a 6-mer synthetic peptide, is a tight junction regulator and absorption enhancer.

     AT-1002 Chemical Structure
  89. GC34477 AT-1002 TFA AT-1002 TFA, a 6-mer synthetic peptide, is a tight junction regulator and absorption enhancer. AT-1002 TFA Chemical Structure
  90. GC42865 AT-121 AT-121 is a dual μ-opioid and nociceptin receptor partial agonist (Kis = 16.49 and 3.67 nM, respectively). AT-121 Chemical Structure
  91. GC39554 AT2 receptor agonist C21 An AT2 receptor agonist AT2 receptor agonist C21 Chemical Structure
  92. GC18133 ATB-346 ATB-346 (ATB-346), an orally active non-steroidal anti-inflammatory drug (NSAID), inhibits cyclooxygenase-1 and 2 (COX-1 and 2). ATB-346 Chemical Structure
  93. GC65596 Atogepant Atogepant (MK-8031) is an orally active and selective calcitonin gene–related peptide receptor (CGRP) antagonist. Atogepant Chemical Structure
  94. GC38497 ATPA ATPA Chemical Structure
  95. GC46891 ATPA (hydrate) An agonist of GluR5 ATPA (hydrate) Chemical Structure
  96. GC15667 Atracurium Besylate Neuromuscular blocking agent Atracurium Besylate Chemical Structure
  97. GC16526 Atropine MAChRs antagonist Atropine Chemical Structure
  98. GC35427 Atropine methyl bromide A muscarinic acetylcholine receptor antagonist Atropine methyl bromide Chemical Structure
  99. GC35428 Atropine sulfate Atropine (Tropine tropate) sulfate is a competitive muscarinic acetylcholine receptor (mAChR) antagonist with IC50 values of 0.39 and 0.71 nM for Human mAChR M4 and Chicken mAChR M4, respectively. Atropine sulfate Chemical Structure
  100. GC63827 Atropine sulfate monohydrate Atropine (Tropine tropate) sulfate monohydrate is a broad-spectrum and competitive muscarinic acetylcholine receptor (mAChR) antagonist with anti-myopia effect. Atropine sulfate monohydrate Chemical Structure
  101. GC46895 Aurintricarboxylic Acid (ammonium salt) A protein synthesis inhibitor with diverse biological activities Aurintricarboxylic Acid (ammonium salt) Chemical Structure

Items 601 to 700 of 3533 total

per page
  2. 5
  3. 6
  4. 7
  5. 8
  6. 9

Set Descending Direction