- Cat.No. 상품명 정보
- GC31523 Peptide YY (PYY) (3-36), human (Peptide YY (3-36)) 펩타이드 YY(PYY)(3-36), 인간(Peptide YY(3-36))은 식욕을 감소시키는 Y2 수용체 작용제로 작용하는 장 호르몬 펩타이드입니다.
-
GC44598
Peptide YY (human) (trifluoroacetate salt)
Peptide YY (PYY) is a 36-amino acid peptide and anorectic gut hormone agonist for the neuropeptide Y receptors Y1, Y2, Y5, and Y6 with EC50 values of 0.7, 0.58, 1, and 0.8 nM, respectively, for supression of forskolin-induced cAMP accumulation.
- GC63855 Peptide YY (PYY) (3-36), porcine TFA 펩타이드 YY(PYY)(3-36), 돼지 TFA는 식욕을 감소시키는 Y2 수용체 작용제로 작용하는 장 호르몬 펩타이드입니다.
- GC36874 Peptide YY (PYY) (3-36), human TFA
- GC63141 Peptide 74 펩타이드 74는 MMP(matrix metalloproteinase)의 프로도메인 서열을 포함하는 합성 펩타이드입니다. 펩티드 74는 시험관 내에서 72-kDa 유형 IV 콜라게나제의 활성화된 형태를 억제합니다.
- GC32335 Peptide T TFA 펩티드 T(TFA)는 HIV-1 gp120의 V2 영역의 옥타펩티드입니다.
- GC32309 Peptide T 펩티드 T는 HIV-1 gp120의 V2 영역의 옥타펩티드입니다.
- GC31767 Peptide 401 봉독의 강력한 비만세포 탈과립 인자인 펩티드 401은 다양한 평활근 경련제(히스타민, 5-HT)의 피내 주사로 인해 증가된 혈관 투과성을 억제합니다.
- GP10131 Peptide YY(3-36), PYY, human
- GC36873 Peptide C105Y α1-항트립신의 잔기 359-374에 해당하는 아미노산 서열을 기반으로 하는 합성 및 세포 투과성 펩티드인 펩티드 C105Y는 DNA 나노입자의 유전자 발현을 향상시킵니다.
- GC52502 Peptide YY (3-36) (trifluoroacetate salt) A satiety hormone
- GA23355 Peptide Lv (rat) Peptide Lv has been discovered via a computational bioinformatics-based screening process. The neuropeptide is expressed in retinal photoreceptor layer, hippocampus, olfactory bulb, cerebellum, cerebral cortex, lung, spleen, liver and intestine. Peptide Lv enhances L-type voltage-gated calcium channel (L-VGCC) currents in retinal photoreceptors.
- GC63347 Peptide 78 펩티드 78, 화학주성 사이토카인, IL-8 또는 C-X-C 케모카인 슈퍼유전자 패밀리의 78개 아미노산 단백질 구성원.
- GC30452 Peptide YY (PYY), human 펩타이드 YY(PYY)는 식욕을 조절하고 췌장 분비를 억제하는 장 호르몬입니다.
- GC30233 Peptide M 펩티드 M은 합성 아미노산(소 S-항원: DTNLASSTIIKEGIDKTV의 아미노산 위치 303-322에 해당하는 길이 18개 아미노산)으로 원숭이 및 하틀리 기니피그 및 루이스 래트에서 실험적 자가면역 포도막염을 유도할 수 있습니다. .
- GA23356 Peptide WE-14 WE-14, a chromogranin A-derived peptide, was isolated from a human ileal carcinoid tumor. Its sequence WSKMDQLAKELTAE is highly conserved in many mammalian species and flanked by typical processing sites. Such factors would indicate a potential physiological role for peptide WE-14.
- GA23357 Peptide YY (13-36) (canine, mouse, porcine, rat) This C-terminal fragment was shown to suppress the noradrenaline release from sympathetic nerve endings. It thereby mimics the effects of PYY and NPY at presynaptic (Y?) receptors. The peptide was also able to compete with NPY for essentially all binding sites in rat brain.
- GA23358 Peptide YY (canine, mouse, porcine, rat)
- GC50439 Peptide5 connexin 43 모방 펩티드인 Peptide5는 척수 손상 후 동물의 부종, 성상교세포증 및 신경 세포 사멸을 감소시킵니다.
- GC30535 Transdermal Peptide (TD 1 (peptide)) Transdermal Peptide (TD 1 (peptide)), consisting of 11 amino acids, is the first transdermal enhancing peptide discovered by phage display.
- GC31527 C-Peptide, dog (C-Peptide (dog)) C-Peptide, dog(C-Peptide(dog))은 프로인슐린의 성분으로 췌장 베타세포에서 인슐린과 함께 혈액으로 방출됩니다.
- GC31172 δ-Sleep Inducing Peptide (Delta-Sleep Inducing Peptide) δ-수면 유도 펩티드(Delta-Sleep Inducing Peptide)는 항산화 및 항불안 특성을 지닌 신경 펩티드입니다.
- GC35123 3X FLAG peptide TFA
- GC34397 Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) Sphistin Synthetic Peptide(12-38, Fitc in N-Terminal-Fluorescently Labeled Peptide)는 강력한 항균 활성을 나타내는 Sphistin Synthetic Peptide의 잘린 단편입니다.
-
GP10149
3X FLAG Peptide
합성 펩타이드 태그
- GC30285 Eledoisin (Eledone peptide) A neurokinin receptor agonist
-
GP10118
Amyloid Beta-Peptide (1-40) (human)
인간 Amyloid β-Peptide (1-40) (C194H295N53O58S1)은 H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH 시퀀스를 가진 펩타이드로, 분자량은 4329.8입니다. 아밀로이드 베타(Aβ 또는 Abeta)는 아밀로이드 전구 단백질에서 처리된 36~43개의 아미노산으로 이루어진 펩타이드입니다.
- GC45382 Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt)
- GC52376 BMP2-derived Peptide (trifluoroacetate salt) A synthetic peptide
- GC44655 PKCε Inhibitor Peptide PKCε 억제제 펩타이드(ε-V1-2), PKCε 유래 펩타이드, 선택적 PKCε 억제제.
- GP10091 Vasonatrin Peptide (1-27) Vasonatrin Peptide (1-27), (C124H198N36O36S3), a peptide with the sequence H2N-GLSKGCFGLKLDRIGSMSGLGCNSFRY-OH, MW= 2865.4.
-
GP10049
Amyloid Beta-Peptide (12-28) (human)
Amyloid Beta-Peptide (12-28) (human) is a peptide fragment of amyloid beta protein (1-42) (Aβ (1-42)).
-
GP10082
Amyloid Beta-peptide (25-35) (human)
알츠하이머 아밀로이드 베타 펩타이드의 단편인 인간 Amyloid beta-peptide (25-35)은 신경독성 효과가 있습니다.
- GC52385 Myelin Basic Protein (85-99) Peptide Antagonist (trifluoroacetate salt) An MBP (85-99) antagonist
- GC66061 Competence-Stimulating Peptide-2 (CSP-2) Competence-Stimulating Peptide-2(CSP-2)는 Streptococcus pneumoniae에 의해 생산되는 정족수 감지 신호 펩티드입니다. 821d96072c2d58d8970e76f526b0f6b8ComD2는 EC50 값이 50.7nM인 Competence-Stimulating Peptide-2(CSP-2)의 호환 가능한 수용체입니다.821d96072c2d58d8970e76f526b0f6b8
- GC52361 AMARA Peptide (trifluoroacetate salt) A peptide substrate for AMPK
- GC52196 RGD Peptide RGD Peptide는 인테그린-리간드 상호작용의 억제제로 작용하며 세포 접착, 이동, 성장 및 분화에 중요한 역할을 합니다.
- GC49883 DAPK Substrate Peptide (trifluoroacetate salt) A DAPK1 peptide substrate
- GC48346 DYKDDDDK Peptide (trifluoroacetate salt)
- GC37524 RGD peptide (GRGDNP) TFA
- GC44806 Ras Inhibitory Peptide Son of sevenless homolog 1 (Sos1) is a guanine nucleotide exchange factor (GEF) that directs the exchange of Ras-GDP to Ras-GTP by binding to SH3 domains of the growth factor receptor-bound protein 2 (Grb2), leading to the activation of ERK.
- GC34274 SPACE peptide SPACE 펩타이드는 피부 투과 펩타이드(SPP)입니다.
-
GC70187
δ-Sleep Inducing Peptide acetate
δ-수면 유도 펩타이드 아세테이트는 신경 펩타이드로, 항산화 및 항불안 작용을 가지고 있습니다.
-
GP10150
FLAG tag Peptide
FLAG 태그 펩타이드는 장 내키나아제 제한부위를 포함하는 8개의 펩타이드 (Asp-Tyr-lys-Asp-Asp-Asp-ASP-ASP-Lys)입니다.
- GP10104 S6 Kinase Substrate Peptide 32 Measures the activity of kinases that phosphorylate ribosomal protein S6.
- GP10108 EGF-R (661-681) T669 Peptide
- GP10011 Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell
- GP10098 Cdk2/Cyclin Inhibitory Peptide I
- GP10094 Amyloid β-peptide (10-35), amide
- GP10147 Ribosomal protein L3 peptide (202-222) amide
- GP10042 Rhodopsin peptide
-
GP10127
Cadherin Peptide, avian
Role in cell adhesion
- GP10095 Epidermal Growth Factor Receptor Peptide (985-996)
-
GP10043
GnRH Associated Peptide (GAP) (1-13), human
Inhibitor of prolactin secretion
-
GP10089
Platelet Membrane Glycoprotein IIB Peptide (296-306)
Inhibits platelet aggregation
-
GP10046
Amyloid Precursor C-Terminal Peptide
For beta amyloid generation
- GP10022 Dynamin inhibitory peptide
- GP10057 Amyloid β-Peptide (10-20) (human)
- GA21428 Erythropoietin Mimetic Peptide Sequence 20 Peptide mimetic of erythropoietin (EPO). EMP-20 has been described to be an excellent starting point for the design of compounds with erythropoietin (EPO) mimetic activity and can serve as a minimal model for an EPO receptor antagonist.
-
GP10152
Influenza Hemagglutinin (HA) Peptide
펩타이드
- GC62069 pm26TGF-β1 peptide TFA
- GC62068 pm26TGF-β1 peptide
- GC38520 PTD-p65-P1 Peptide TFA PTD-p65-P1 펩타이드 TFA는 강력한 선택적 핵 전사 인자 NF-κB 억제제이며 다양한 염증 자극에 의해 유도된 NF-κB 활성화를 선택적으로 억제하는 NF-κB 아미노산 잔기 271-282의 p65 서브유닛에서 파생됩니다. -NF-κB 매개 유전자 발현을 조절하고 세포 사멸을 상향 조절합니다.
- GC64248 c-Myc Peptide TFA c-Myc Peptide(TFA)는 인간 c-myc 단백질의 C-말단 아미노산(410-419)에 해당하는 합성 펩타이드로, 성장 관련 유전자 전사 조절에 관여합니다.
- GC63708 Uty HY Peptide (246-254) (TFA) Uty HY Peptide (246-254) TFA는 Y 염색체(UTY) 단백질의 유비쿼터스 전사된 테트라트리코펩티드 반복 유전자에서 H-Y 에피토프인 H-YDb로 남성 특이적 이식 항원 H-Y입니다.
- GC63447 C-Type Natriuretic Peptide (CNP) (1-22), human TFA C-Type Natriuretic Peptide(CNP)(1-22), 인간(TFA), CNP의 1-22 단편은 나트륨 이뇨 펩티드 수용체 B(NPR-B) 작용제입니다.
- GC61345 Transdermal Peptide Disulfide TFA Transdermal Peptide Disulfide TFA(TD 1 Disulfide(peptide) TFA)는 11개의 아미노산으로 구성된 펩타이드로 Na+/K+-ATPase beta-subunit(ATP1B1)에 결합하며 주로 C-말단과 상호작용합니다. ATP1B1.
- GC60095 Brain Natriuretic Peptide (1-32), rat acetate Brain Natriuretic Peptide(1-32), rat acetate(BNP(1-32), rat acetate)는 심장근육세포(cardiomyocytes)의 과도한 스트레칭에 대한 반응으로 심장의 심실에서 분비되는 32개 아미노산의 폴리펩타이드입니다. .
- GC36150 Glucagon-Like Peptide (GLP) I (7-36), amide, human Glucagon-Like Peptide (GLP) I (7-36), amide, human은 인슐린 분비를 자극하는 생리학적 인크레틴 호르몬입니다.
-
GC36041
Fibronectin Adhesion-promoting Peptide
Fibronectin 접착 촉진 펩타이드는 섬유아세포에서 스트레스 섬유 및 초점접착을 유도하는 강력한 인자로, 이것은 대동맥 경화성 심혈관 질환과 관련된 혈전 생성에 관여합니다.
- GC35426 Atrial Natriuretic Peptide (ANP) (1-28), rat TFA ANP(Atrial Natriuretic Peptide)(1-28), 쥐(TFA)는 쥐에서 ANP의 주요 순환 형태이며 농도 의존적 방식으로 안지오텐신 II(Ang II) 자극 엔도텔린-1 분비를 강력하게 억제합니다.
- GC34023 Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Atrial Natriuretic Peptide (ANP) (1-28), 인간, 돼지 (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine)는 인간의 심장에서 정상적으로 생성 및 분비되는 28-아미노산 호르몬입니다. 심장 손상 및 기계적 신장에 대한 반응.
- GC33690 Crustacean Cardioactive Peptide CCAP 갑각류 Cardioactive Peptide CCAP는 고도로 보존된 아미드화 환형 노나펩티드로 해안 게 Carcinus maenas의 심낭 기관에서 처음 분리되었으며, 여기서 심장 박동을 조절하는 역할을 합니다. 갑각류 Cardioactive Peptide CCAP는 또한 다른 절지동물의 신경 활동을 조절합니다.
- GC33599 PAR-4 Agonist Peptide, amide TFA (PAR-4-AP (TFA)) PAR-4 Agonist Peptide, amide TFA (PAR-4-AP (TFA)) (PAR-4-AP TFA; AY-NH2 TFA)는 proteinase-activated receptor-4 (PAR-4) agonist로 효과가 없다 PAR-1 또는 PAR-2에 작용하며 PAR-4 길항제에 의해 효과가 차단됩니다.
- GC33448 OVA Peptide 257-264 OVA 펩티드 257-264는 OVA의 클래스 I(Kb)-제한된 펩티드 에피토프이며, 팔량체 펩티드는 클래스 I MHC 분자, H-2Kb에 의해 제시된 오브알부민에서 유래할 수 있습니다.
- GC32612 BNP-45 rat (Brain natriuretic peptide-45 rat) BNP-45 쥐(Brain natriuretic peptide-45 rat)(BNP-45, 쥐)는 강력한 저혈압 및 나트륨 이뇨 효능을 가진 쥐 심장에서 분리된 순환 형태의 쥐 뇌 나트륨 이뇨 펩티드입니다.
- GC32589 Brain Natriuretic Peptide (BNP) (1-32), rat Brain Natriuretic Peptide(BNP)(1-32), rat(BNP(1-32), rat)는 심장 근육 세포(cardiomyocytes)의 과도한 스트레칭에 반응하여 심장의 심실에서 분비되는 32개 아미노산의 폴리펩타이드입니다.
- GC32299 Bombinin-Like Peptide BLP-1 Bombinin-Like Peptide BLP-1은 Bombina 종의 항균성 펩타이드입니다.
- GC64476 Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat acetate 수초 희소돌기아교세포 당단백질 펩티드(35-55), 마우스, 쥐(MOG(35-55)) 아세테이트는 CNS 수초의 부성분입니다.
- GC63889 Proteasome-activating peptide 1 TFA 프로테아좀 활성화 펩타이드 1 TFA는 펩타이드이자 강력한 프로테아좀 활성화제입니다.
- GC63766 G-Protein antagonist peptide TFA G-단백질 길항제 펩티드 TFA는 절단된 물질 P-관련 펩티드이며, G 단백질 결합에 대해 수용체와 경쟁한다.
- GC61375 VSV-G tag Peptide VSV-G 펩타이드는 수포성 구내염 바이러스 당단백질에서 파생된 11개 아미노산 펩타이드입니다.
- GC36893 Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa Phe-Met-Arg-Phe 펩타이드와 유사한 Snail Helix aspersa는 snail Helix aspersa의 내장 및 체세포 근육에서 추출한 FMRF 유사 펩타이드입니다.
- GC36670 Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat (TFA)
- GC36467 LL-37 scrambled peptide LL-37 스크램블 펩타이드는 카텔리시딘 항균 펩타이드 LL-37의 스크램블 버전입니다.
- GC35549 Brain Natriuretic Peptide (BNP) (1-32), rat TFA
- GC44654 PKCα (C2-4) Inhibitor Peptide The C2 domain of conventional PKC isoforms mediates calcium-dependent translocation.
- GC42871 Atrial Natriuretic Peptide (1-28) (rat) (trifluoroacetate salt) Atrial natriuretic peptide (ANP) is an endogenous peptide generated by proteolysis of prepro-ANP that is secreted by cardiomyocytes in the heart.
- GC34400 c-Myc Peptide Trifluoroacetate
- GC34396 Calcitonin Gene Related Peptide (CGRP) (83-119), rat
- GC34395 Calcitonin Gene Related Peptide (CGRP) (83-119), rat TFA
- GC34266 OVA Peptide 323-339 OVA 펩티드(323-339)는 BALB/c 마우스에서 즉각적인 과민 반응의 생성 및 발달에 중요한 Ovalbumin(Ova)의 T 및 B 세포 에피토프를 나타냅니다.
- GC34233 PACAP-Related Peptide (PRP), human PACAP 관련 펩타이드(PRP), 인간은 PACAP 전구체 단백질의 29개 아미노산 영역입니다.
- GC34025 Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate Atrial Natriuretic Peptide (ANP) (1-28), 인간, 돼지 아세테이트 (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine acetate)는 28-아미노산 호르몬으로 정상적으로 생성되고 분비됩니다. 심장 손상 및 기계적 스트레칭에 대한 반응으로 인간의 심장.
- GC33600 OVA Peptide (257-264) TFA OVA 펩티드(257-264) TFA는 OVA의 클래스 I(Kb)-제한된 펩티드 에피토프이며, 팔량체 펩티드는 클래스 I MHC 분자, H-2Kb에 의해 제시된 오브알부민에서 유래할 수 있습니다.
- GC33585 β-catenin peptide β-catenin 펩타이드는 8-aa 펩타이드이며 흉선 세포 양성 선택을 촉진할 수 있습니다.
- GC15099 Autocamtide-2-related inhibitory peptide Autocamtide-2 관련 억제 펩타이드는 40 nM의 IC50으로 CaMKII의 매우 특이적이고 강력한 억제제입니다.
-
GC68908
C-Type Natriuretic Peptide (1-53), human TFA
C-형 나트륨뇨펩타이드 (1-53), 인간 TFA는 C-형 나트륨뇨펩타이드의 1-53 조각입니다. C-Type Natriuretic Peptide TFA는 이뇨나트륨펩타이드 가족의 펩타이드로, 전해질 - 액체 균형과 혈관 긴장을 유지하는 데 참여합니다.
- GP10151 c-Myc tag Peptide
-
GP10112
TRH Precursor Peptide
Thyrotropin Releasing Hormone Precursor Peptide